DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17124 and ppp1r14ab

DIOPT Version :10

Sequence 1:NP_609450.1 Gene:CG17124 / 34485 FlyBaseID:FBgn0032297 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_957104.1 Gene:ppp1r14ab / 393783 ZFINID:ZDB-GENE-040426-1783 Length:148 Species:Danio rerio


Alignment Length:117 Identity:36/117 - (30%)
Similarity:61/117 - (52%) Gaps:19/117 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NDCERSPNRTNLRVNFNEKGAEVKERREKFLTAKYGSHQMSLIRKRLAVEMWLYDELQKLF---- 69
            |:...||||...|    |.|..|::|:.: :|.||...:   :::||.||.|:...|.:|:    
Zfish    11 NNKIHSPNRGASR----EAGLSVQKRQAR-VTVKYNRKE---LQRRLDVEKWIDCGLDELYLGRE 67

  Fly    70 -DPPNEAIDVDIDEILDMDTDDIRRSHLIRLLSVCKRPQSDISKFIGDLLDR 120
             :.|.|   |:|||:||:.:|:.|...|..:|..|   .::...||.:|:.:
Zfish    68 DEMPEE---VNIDELLDLQSDEERTQKLKDILHAC---SNNTEVFITELVKK 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17124NP_609450.1 PP1_inhibitor 9..124 CDD:461630 36/117 (31%)
ppp1r14abNP_957104.1 PP1_inhibitor 1..143 CDD:461630 36/117 (31%)

Return to query results.
Submit another query.