DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17124 and F55C10.5

DIOPT Version :9

Sequence 1:NP_001285813.1 Gene:CG17124 / 34485 FlyBaseID:FBgn0032297 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001379405.1 Gene:F55C10.5 / 3564818 WormBaseID:WBGene00010109 Length:112 Species:Caenorhabditis elegans


Alignment Length:118 Identity:40/118 - (33%)
Similarity:60/118 - (50%) Gaps:25/118 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FNEKGAEV------KERREKFLTAKYGSHQMSLIRKRLAVEMWLYDELQKLFDPPNEA--IDVDI 80
            |.||.|..      .|.|.:.||.|||.|||:|||||:.||.|:..|:.|||: .||.  :|:|:
 Worm     3 FGEKHARFGDSKSRMEDRSRVLTMKYGKHQMALIRKRMKVENWIETEVTKLFN-GNETNNVDIDL 66

  Fly    81 DEILDMDT---------DDIRRSHLIRLLSVCKRPQSDISKFIGDLLDRAKTL 124
            |.|.|::.         :.::::|       |......|..|:.:|:.:..||
 Worm    67 DVIQDIEDVTGKRKFAFEQLQKAH-------CPCSMDKIIMFLDELIIQLNTL 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17124NP_001285813.1 PP1_inhibitor 9..124 CDD:398826 38/116 (33%)
F55C10.5NP_001379405.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159601
Domainoid 1 1.000 58 1.000 Domainoid score I7215
eggNOG 1 0.900 - - E1_KOG0824
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I4020
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492626at2759
OrthoFinder 1 1.000 - - FOG0000782
OrthoInspector 1 1.000 - - oto19704
orthoMCL 1 0.900 - - OOG6_108948
Panther 1 1.100 - - LDO PTHR16188
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5503
SonicParanoid 1 1.000 - - X13785
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.