DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17124 and RGD1309049

DIOPT Version :9

Sequence 1:NP_001285813.1 Gene:CG17124 / 34485 FlyBaseID:FBgn0032297 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001013978.1 Gene:RGD1309049 / 301306 RGDID:1309049 Length:147 Species:Rattus norvegicus


Alignment Length:101 Identity:34/101 - (33%)
Similarity:55/101 - (54%) Gaps:9/101 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NEKGAEVKERREKFLTAKYGSHQMSLIRKRLAVEMWLYDELQKLFDPPNEAI---DVDIDEILDM 86
            |:...:...||......||...:   :||||.::.|:.::|..|:|...|.|   ::|:||:|||
  Rat    42 NKPDEDEPVRRPGKTVVKYNRKE---LRKRLKLDEWILEQLTGLYDCKEEEIPELEIDVDELLDM 103

  Fly    87 DTDDIRRSHLIRLLSVCKRPQSDISKFIGDLLDRAK 122
            ::||.|.:.:..||..|.:|   ...||.||||:.:
  Rat   104 ESDDTRAARVKELLVDCYKP---TETFINDLLDKIR 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17124NP_001285813.1 PP1_inhibitor 9..124 CDD:398826 34/101 (34%)
RGD1309049NP_001013978.1 PP1_inhibitor 51..147 CDD:398826 33/92 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341433
Domainoid 1 1.000 61 1.000 Domainoid score I10176
eggNOG 1 0.900 - - E1_KOG0824
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5296
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492626at2759
OrthoFinder 1 1.000 - - FOG0000782
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108948
Panther 1 1.100 - - O PTHR16188
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.