DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17124 and PPP1R14B

DIOPT Version :9

Sequence 1:NP_001285813.1 Gene:CG17124 / 34485 FlyBaseID:FBgn0032297 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_619634.1 Gene:PPP1R14B / 26472 HGNCID:9057 Length:147 Species:Homo sapiens


Alignment Length:92 Identity:34/92 - (36%)
Similarity:55/92 - (59%) Gaps:9/92 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RREKFLTAKYGSHQMSLIRKRLAVEMWLYDELQKLFDPPNEAI---DVDIDEILDMDTDDIRRSH 95
            ||:..:|.||...:   :||||.:|.|:.::|.:|:|...|.|   ::|:||:|||::||.|.:.
Human    51 RRQGKVTVKYDRKE---LRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAAR 112

  Fly    96 LIRLLSVCKRPQSDISKFIGDLLDRAK 122
            :..||..|.:|   ...||..|||:.:
Human   113 VKELLVDCYKP---TEAFISGLLDKIR 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17124NP_001285813.1 PP1_inhibitor 9..124 CDD:398826 34/92 (37%)
PPP1R14BNP_619634.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 2/3 (67%)
PP1_inhibitor 51..147 CDD:398826 34/92 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147612
Domainoid 1 1.000 61 1.000 Domainoid score I10471
eggNOG 1 0.900 - - E1_KOG0824
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492626at2759
OrthoFinder 1 1.000 - - FOG0000782
OrthoInspector 1 1.000 - - oto91163
orthoMCL 1 0.900 - - OOG6_108948
Panther 1 1.100 - - O PTHR16188
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5503
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.