powered by:
Protein Alignment CG17124 and Y105E8A.14
DIOPT Version :9
Sequence 1: | NP_001285813.1 |
Gene: | CG17124 / 34485 |
FlyBaseID: | FBgn0032297 |
Length: | 124 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_740943.2 |
Gene: | Y105E8A.14 / 173308 |
WormBaseID: | WBGene00013674 |
Length: | 224 |
Species: | Caenorhabditis elegans |
Alignment Length: | 35 |
Identity: | 9/35 - (25%) |
Similarity: | 17/35 - (48%) |
Gaps: | 11/35 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 KLFDPPNEAID--VDI---------DEILDMDTDD 90
::|..|.:|:| :|| |.::..:.||
Worm 70 QIFKKPLQAVDLKMDIPGTPSAAAPDPVVKQEVDD 104
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17124 | NP_001285813.1 |
PP1_inhibitor |
9..124 |
CDD:398826 |
9/35 (26%) |
Y105E8A.14 | NP_740943.2 |
RING |
23..67 |
CDD:238093 |
|
WWE |
130..202 |
CDD:128922 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0824 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.