DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17124 and ppp1r14d

DIOPT Version :9

Sequence 1:NP_001285813.1 Gene:CG17124 / 34485 FlyBaseID:FBgn0032297 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001082974.1 Gene:ppp1r14d / 100037351 ZFINID:ZDB-GENE-070410-123 Length:122 Species:Danio rerio


Alignment Length:110 Identity:43/110 - (39%)
Similarity:61/110 - (55%) Gaps:10/110 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TNLRVNFNEKGAEVKERREKFLTAKYGSHQMSLIRKRLAVEMWLYDELQKLFDPPNEAI---DVD 79
            |..||.|..|..|..:|:...||.||....   :::||.:|.|:.|:|..|:|...|.|   ::|
Zfish    11 TQSRVMFQTKEEEPAQRKLGKLTVKYNRKD---LQRRLDIEEWIDDQLHLLYDCQEEEIPELEID 72

  Fly    80 IDEILDMDTDDIRRSHLIRLLSVCKRPQSDISKFIGDLLDRAKTL 124
            |||:|:: ||:.:||.|..||..|.:|:.|   ||..||.|.|.|
Zfish    73 IDELLEL-TDEEQRSRLHELLQDCGKPKED---FINGLLYRMKGL 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17124NP_001285813.1 PP1_inhibitor 9..124 CDD:398826 42/108 (39%)
ppp1r14dNP_001082974.1 PP1_inhibitor 25..115 CDD:283108 37/96 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581418
Domainoid 1 1.000 61 1.000 Domainoid score I10414
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5380
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492626at2759
OrthoFinder 1 1.000 - - FOG0000782
OrthoInspector 1 1.000 - - oto40422
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.