DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17124 and ppp1r14bb

DIOPT Version :9

Sequence 1:NP_001285813.1 Gene:CG17124 / 34485 FlyBaseID:FBgn0032297 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001002692.1 Gene:ppp1r14bb / 100000577 ZFINID:ZDB-GENE-030616-595 Length:128 Species:Danio rerio


Alignment Length:110 Identity:38/110 - (34%)
Similarity:60/110 - (54%) Gaps:14/110 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RVNFNEKGAEVKE-----RREKFLTAKYGSHQMSLIRKRLAVEMWLYDELQKLFDPPNEAI---D 77
            ||.|.......:|     |::..:|.||...:   :||||.:|.|:.|:|..|:|...|||   :
Zfish    14 RVYFQTPTGSTEETETPVRKQGRVTVKYDRKE---LRKRLNLEEWIIDQLTDLYDCEEEAIPELE 75

  Fly    78 VDIDEILDMDTDDIRRSHLIRLLSVCKRPQSDISKFIGDLLDRAK 122
            :|:||:|||:.|..|.:.:..||..|.:|..:   |:.:||||.:
Zfish    76 IDVDELLDMENDVDRAARVKELLVDCYKPTEE---FVAELLDRIR 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17124NP_001285813.1 PP1_inhibitor 9..124 CDD:398826 38/110 (35%)
ppp1r14bbNP_001002692.1 PP1_inhibitor 17..128 CDD:283108 36/107 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581417
Domainoid 1 1.000 61 1.000 Domainoid score I10414
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5380
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492626at2759
OrthoFinder 1 1.000 - - FOG0000782
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108948
Panther 1 1.100 - - O PTHR16188
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5503
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.