DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12299 and ZBTB2

DIOPT Version :9

Sequence 1:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster
Sequence 2:NP_065912.1 Gene:ZBTB2 / 57621 HGNCID:20868 Length:514 Species:Homo sapiens


Alignment Length:450 Identity:101/450 - (22%)
Similarity:151/450 - (33%) Gaps:119/450 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 ESVQPLHGLVAGPGYNEFQLQMT------------DPRESTSIFMVQPTVSVTPLQQL------- 210
            :.|.||...:.|....:.||:..            |||..||....:.....:.|.||       
Human   123 DQVFPLASSLYGIQIADHQLRQATKIASAPEKLGRDPRPQTSRISQEQVPEASQLSQLTSNLAQV 187

  Fly   211 ----LPPAPTVSPGLG--LQSTPIKRRRGRRSNIGAPVMDPALNGNQKCFQCTHCEASFPNAGDL 269
                :.|:..:...|.  |.|||:               .|...|.:     |:.|||..:....
Human   188 NRTNMTPSDPLQTSLSPELVSTPV---------------PPPPPGEE-----TNLEASSSDEQPA 232

  Fly   270 S---KHVRSHITN------KPFQCSICQKTFTHIGSLNTHIRIHS---------GEKPYKCELC- 315
            |   .||:..|..      |.:.|.:|.:.||...||..|::||:         ||......|| 
Human   233 SLTIAHVKPSIMKRNGSFPKYYACHLCGRRFTLRSSLREHLQIHTGVPFTSSQQGESRVPLTLCS 297

  Fly   316 ------------PKAFTQSSSLMVHMRSHSVRKPHQCVQCDKGFINYSSLLLHQKTHIAPTETFI 368
                        |:|...|.|.:.|:....:....|..:..            ..:.||..:...
Human   298 NAADLGKDAMEVPEAGMISDSELQHISDSPIIDGQQQSETP------------PPSDIADIDNLE 350

  Fly   369 CPECEREFKAEALLDEHMRMHTQELVYQCAICREAFRASSELVQHMKNHMGEKPFTCSLCDRSFT 433
            ..:.|||.|...              |:|.||...|...|...:||..|.| |||.||.||:||.
Human   351 QADQEREVKRRK--------------YECTICGRKFIQKSHWREHMYIHTG-KPFKCSTCDKSFC 400

  Fly   434 QSGSLNIHMRIHTGEKPFQCKLCDK-----CFTQASSLSVHMKIHAGEKPYPCPICGKSYSQQAY 493
            ::.....|:.::.....:  .:.||     |..:..|...:|.:.. .|||.|.:|.|::|....
Human   401 RANQAARHVCLNQSIDTY--TMVDKQTLELCTFEEGSQMDNMLVQT-NKPYKCNLCDKTFSTPNE 462

  Fly   494 LNKHIQAHQMASAASASTSPGLLVAKQPHETLVCIVCGSLHADATALASHVHSQHAALLD 553
            :.||...:|.:...:......:|:.....|.        ...|...|||....|...|||
Human   463 VVKHSCQNQNSDVFALDEGRSILLGSGDSEV--------TEPDHPVLASIKKEQETVLLD 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 40/189 (21%)
C2H2 Zn finger 256..276 CDD:275368 7/22 (32%)
zf-H2C2_2 268..293 CDD:290200 8/33 (24%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
zf-H2C2_2 296..321 CDD:290200 11/46 (24%)
zf-C2H2_2 312..>387 CDD:289522 14/87 (16%)
C2H2 Zn finger 312..332 CDD:275368 7/32 (22%)
C2H2 Zn finger 340..360 CDD:275368 0/19 (0%)
C2H2 Zn finger 369..389 CDD:275368 4/19 (21%)
C2H2 Zn finger 397..417 CDD:275368 7/19 (37%)
zf-H2C2_2 409..434 CDD:290200 13/24 (54%)
C2H2 Zn finger 425..445 CDD:275368 7/19 (37%)
zf-H2C2_2 437..462 CDD:290200 4/29 (14%)
C2H2 Zn finger 453..473 CDD:275368 5/24 (21%)
zf-H2C2_2 465..490 CDD:290200 8/24 (33%)
C2H2 Zn finger 481..501 CDD:275368 6/19 (32%)
ZBTB2NP_065912.1 BTB 14..>84 CDD:306997
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..231 20/101 (20%)
C2H2 Zn finger 256..276 CDD:275368 7/19 (37%)
zf-C2H2 363..385 CDD:306579 8/21 (38%)
C2H2 Zn finger 365..385 CDD:275368 7/19 (37%)
zf-H2C2_2 377..399 CDD:316026 11/22 (50%)
C2H2 Zn finger 392..443 CDD:275368 12/52 (23%)
C2H2 Zn finger 450..466 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.