DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12299 and LOC571721

DIOPT Version :9

Sequence 1:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster
Sequence 2:XP_021331497.1 Gene:LOC571721 / 571721 -ID:- Length:421 Species:Danio rerio


Alignment Length:313 Identity:116/313 - (37%)
Similarity:164/313 - (52%) Gaps:28/313 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 RRRGR--------RSNIGAPVMDPALNGNQKCFQCTHCEASFPNAGDLSKHVRSHITNKPFQCSI 286
            :.||:        ..|:|....|..|       .|..|..||.:..:|..|:|.|..:||.||..
Zfish   103 QHRGKSFSQQKHLEGNVGIHTGDEPL-------ACHQCGKSFNHKQNLKIHMRIHTGDKPNQCQQ 160

  Fly   287 CQKTFTHIGSLNTHIRIHSGEKPYKCELCPKAFTQSSSLMVHMRSHSVRKPHQCVQCDKGFINYS 351
            |.|:|.|..:|..|:|:|:|||||.|:.|.|:|:|.::|..|||.||..||..|.:|.|.|::..
Zfish   161 CGKSFIHKQNLKVHMRVHTGEKPYHCQHCGKSFSQQTNLEGHMRIHSGVKPFTCQECGKSFVHKH 225

  Fly   352 SLLLHQKTHIAPTETFICPECEREFKAEALLDEHMRMHTQELVYQCAICREAFRASSELVQHMKN 416
            :|.||.:.|.. .:.|.|..|.:.|..:..|..|:|:||.|..::|..|.:.|.....|..|::.
Zfish   226 NLQLHLRVHTG-EKPFKCQHCGKGFVHKHNLQLHLRVHTGEKPFKCQHCGKGFSLQKNLDGHVRI 289

  Fly   417 HMGEKPFTCSLCDRSFTQSGSLNIHMRIHTGEKPFQCKLCDKCFTQASSLSVHMKIHAGEKPYPC 481
            |.|||||:|..|.:||....:..:|||:||||||:||:.|.|.|:..:||..||.||.|.||:.|
Zfish   290 HTGEKPFSCPQCGKSFIDKQNFKVHMRVHTGEKPYQCQQCGKGFSLKASLDCHMSIHTGLKPFVC 354

  Fly   482 PICGKSYSQQAYLNKHIQAH-----QMASAASASTSPGLL-------VAKQPH 522
            ..||||:.|:..|..|::.|     .|.......|..|.|       .|::||
Zfish   355 QQCGKSFHQRPKLKLHMRVHTGEKPYMCQCGKRFTENGQLKRHMITHTAEKPH 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 60/158 (38%)
C2H2 Zn finger 256..276 CDD:275368 7/19 (37%)
zf-H2C2_2 268..293 CDD:290200 11/24 (46%)
C2H2 Zn finger 284..304 CDD:275368 8/19 (42%)
zf-H2C2_2 296..321 CDD:290200 13/24 (54%)
zf-C2H2_2 312..>387 CDD:289522 27/74 (36%)
C2H2 Zn finger 312..332 CDD:275368 9/19 (47%)
C2H2 Zn finger 340..360 CDD:275368 7/19 (37%)
C2H2 Zn finger 369..389 CDD:275368 6/19 (32%)
C2H2 Zn finger 397..417 CDD:275368 5/19 (26%)
zf-H2C2_2 409..434 CDD:290200 12/24 (50%)
C2H2 Zn finger 425..445 CDD:275368 7/19 (37%)
zf-H2C2_2 437..462 CDD:290200 14/24 (58%)
C2H2 Zn finger 453..473 CDD:275368 8/19 (42%)
zf-H2C2_2 465..490 CDD:290200 14/24 (58%)
C2H2 Zn finger 481..501 CDD:275368 8/19 (42%)
LOC571721XP_021331497.1 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 130..150 CDD:275368 7/19 (37%)
COG5048 <153..307 CDD:227381 63/154 (41%)
C2H2 Zn finger 158..178 CDD:275368 8/19 (42%)
C2H2 Zn finger 186..206 CDD:275368 9/19 (47%)
C2H2 Zn finger 214..234 CDD:275368 7/19 (37%)
C2H2 Zn finger 242..262 CDD:275368 6/19 (32%)
C2H2 Zn finger 270..290 CDD:275368 5/19 (26%)
C2H2 Zn finger 298..318 CDD:275368 7/19 (37%)
zf-H2C2_2 310..334 CDD:316026 13/23 (57%)
C2H2 Zn finger 326..346 CDD:275368 8/19 (42%)
C2H2 Zn finger 354..374 CDD:275368 8/19 (42%)
C2H2 Zn finger 382..401 CDD:275368 3/18 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595107
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.