DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12299 and zbtb43

DIOPT Version :9

Sequence 1:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster
Sequence 2:NP_001103494.1 Gene:zbtb43 / 557590 ZFINID:ZDB-GENE-060526-378 Length:410 Species:Danio rerio


Alignment Length:111 Identity:40/111 - (36%)
Similarity:53/111 - (47%) Gaps:14/111 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 ASSELVQHMKNHMG-----EKPFTCSLCDRSFTQSGSLNIHMRIHTGEKPFQCKLCDKCFTQASS 465
            |.||    ..:|.|     .|.:.|. |.:|||.....:.||.:|.|.:||.|.:|.|.|.....
Zfish   302 ADSE----QTSHSGFASVVYKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPFGCAVCGKSFKMKHH 361

  Fly   466 LSVHMKIHAGEKPYPCPICGKSYSQQAYLNKH----IQAHQMASAA 507
            |..|||||.|.|||.|.:|.|.:..:...|:|    .:|||...|:
Zfish   362 LVGHMKIHTGIKPYECSLCSKRFMWRDSFNRHTSTCAKAHQTRRAS 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 3/6 (50%)
C2H2 Zn finger 256..276 CDD:275368
zf-H2C2_2 268..293 CDD:290200
C2H2 Zn finger 284..304 CDD:275368
zf-H2C2_2 296..321 CDD:290200
zf-C2H2_2 312..>387 CDD:289522
C2H2 Zn finger 312..332 CDD:275368
C2H2 Zn finger 340..360 CDD:275368
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..417 CDD:275368 3/10 (30%)
zf-H2C2_2 409..434 CDD:290200 8/29 (28%)
C2H2 Zn finger 425..445 CDD:275368 7/19 (37%)
zf-H2C2_2 437..462 CDD:290200 10/24 (42%)
C2H2 Zn finger 453..473 CDD:275368 8/19 (42%)
zf-H2C2_2 465..490 CDD:290200 13/24 (54%)
C2H2 Zn finger 481..501 CDD:275368 5/23 (22%)
zbtb43NP_001103494.1 BTB 23..123 CDD:279045
BTB 34..124 CDD:197585
C2H2 Zn finger 323..341 CDD:275368 6/18 (33%)
C2H2 Zn finger 349..369 CDD:275368 8/19 (42%)
zf-H2C2_2 361..384 CDD:290200 13/22 (59%)
C2H2 Zn finger 377..396 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.