DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12299 and zgc:193790

DIOPT Version :9

Sequence 1:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster
Sequence 2:NP_001122163.1 Gene:zgc:193790 / 557346 ZFINID:ZDB-GENE-080723-55 Length:288 Species:Danio rerio


Alignment Length:248 Identity:94/248 - (37%)
Similarity:141/248 - (56%) Gaps:3/248 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 FQCTHCEASFPNAGDLSKHVRSHITNKPFQCSICQKTFTHIGSLNTHIRIHSGEKPYKCELCPKA 318
            |.|:.|..::....||:.|:|:|...:.|.|:.|.|:||..|.|:.|:|:|:||||::|..|.:|
Zfish    38 FNCSDCGRNYKYKSDLNSHMRTHTGERLFTCTKCGKSFTTSGKLHVHMRVHTGEKPFECSQCGQA 102

  Fly   319 FTQSSSLMVHMRSHSVRKPHQCVQCDKGFINYSSLLLHQKTHIAPTETFICPECEREFKAEALLD 383
            :..::.|:.|.|.|:..||..|..|.|.|.:..:|..|.::| ...:.|.|..|::.|..:|||.
Zfish   103 YKNNADLITHRRVHTGMKPFNCKHCRKSFTSKGALRHHLRSH-TDKKPFSCSHCDKTFLTKALLK 166

  Fly   384 EHMRMHTQELVYQCAICREAFRASSELVQHMKNHMGEKPFTCSLCDRSFTQSGSLNIHMRIHTGE 448
            .|:.:||....:.|::|...|....:|..|...|.||||..||.|.:||..|.:|.||.||||||
Zfish   167 RHLVVHTAAKPHACSVCGNTFLYLQKLKVHELIHTGEKPHKCSDCGKSFRTSSNLKIHQRIHTGE 231

  Fly   449 KPFQCKLCDKCFTQASSLSVHMKIHAGEKPYPCPICGKSYSQQAYLNKHIQAH 501
            ||.||..|:|.:..:|:|.||.|.|  .:...|..||:|:|:.:.|..|.:.|
Zfish   232 KPHQCSDCEKSYPTSSALKVHQKSH--NRVIVCSQCGRSFSRLSSLTNHQRVH 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 53/158 (34%)
C2H2 Zn finger 256..276 CDD:275368 6/19 (32%)
zf-H2C2_2 268..293 CDD:290200 10/24 (42%)
C2H2 Zn finger 284..304 CDD:275368 9/19 (47%)
zf-H2C2_2 296..321 CDD:290200 11/24 (46%)
zf-C2H2_2 312..>387 CDD:289522 24/74 (32%)
C2H2 Zn finger 312..332 CDD:275368 6/19 (32%)
C2H2 Zn finger 340..360 CDD:275368 6/19 (32%)
C2H2 Zn finger 369..389 CDD:275368 7/19 (37%)
C2H2 Zn finger 397..417 CDD:275368 5/19 (26%)
zf-H2C2_2 409..434 CDD:290200 12/24 (50%)
C2H2 Zn finger 425..445 CDD:275368 10/19 (53%)
zf-H2C2_2 437..462 CDD:290200 15/24 (63%)
C2H2 Zn finger 453..473 CDD:275368 8/19 (42%)
zf-H2C2_2 465..490 CDD:290200 9/24 (38%)
C2H2 Zn finger 481..501 CDD:275368 7/19 (37%)
zgc:193790NP_001122163.1 C2H2 Zn finger 40..60 CDD:275368 6/19 (32%)
COG5048 <45..242 CDD:227381 76/197 (39%)
zf-H2C2_2 52..77 CDD:290200 10/24 (42%)
C2H2 Zn finger 68..88 CDD:275368 9/19 (47%)
C2H2 Zn finger 96..116 CDD:275368 6/19 (32%)
C2H2 Zn finger 124..144 CDD:275368 6/19 (32%)
C2H2 Zn finger 152..172 CDD:275368 7/19 (37%)
C2H2 Zn finger 180..200 CDD:275368 5/19 (26%)
zf-H2C2_2 193..217 CDD:290200 12/23 (52%)
C2H2 Zn finger 208..228 CDD:275368 10/19 (53%)
zf-H2C2_2 220..243 CDD:290200 15/22 (68%)
C2H2 Zn finger 236..256 CDD:275368 8/19 (42%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.