DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12299 and si:dkey-262g12.9

DIOPT Version :9

Sequence 1:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster
Sequence 2:XP_021331485.1 Gene:si:dkey-262g12.9 / 555910 ZFINID:ZDB-GENE-161017-28 Length:380 Species:Danio rerio


Alignment Length:321 Identity:109/321 - (33%)
Similarity:157/321 - (48%) Gaps:33/321 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 QSTPIKRRRGRRSNIGAPVMDPALNGNQKCFQCTHCEASFPNAGDLSKHVRSHITNKPFQCSICQ 288
            :::|.||.:..:|           :||   |.|:....||....:|..|:.:....||:.|..|.
Zfish    65 KASPHKRAQKTKS-----------DGN---FTCSQGGMSFTQKNNLVDHMSARSEEKPYPCPECG 115

  Fly   289 KTFTHIGSLNTHIRIHSGEKPYKCELCPKAFTQSSSLMVHMRSHSVRKPHQCVQCDKGFINYSSL 353
            |.|.....|..|:|:|:||||:.|:||.|:|....::.:|.|.|:..:|:.|.||.|.|.....|
Zfish   116 KGFRKKHILAVHMRVHTGEKPFSCDLCGKSFNLQKNMKIHRRIHTGERPYACQQCGKRFRQIQIL 180

  Fly   354 LLHQKTHIAPTETFICPECEREFKAEALLDEHMRMHTQELVYQCAICREAFRASSELVQHMKNHM 418
            ..|.|.|.. ...:.|.:|...|..:..|:.||.:|..|..:.|..|...|.....|..|||.|.
Zfish   181 KNHIKLHTG-ERPYACAQCGMSFIQKQKLEAHMAVHNTERPFACHQCGGNFAHKDYLTIHMKIHS 244

  Fly   419 GEKPFTCSLCDRSFTQSGSLNIHMRIHTGEKPFQCKLCDKCFTQASSLSVHMKIHAGEKPYPCPI 483
            |||||.|..|.:||.:...|.:|||:||||||:.|..|.|.|||.::|:.||:.|.|||||.|.|
Zfish   245 GEKPFACQQCGKSFNRRQCLKVHMRVHTGEKPYICAQCGKSFTQKNNLNYHMRTHTGEKPYTCSI 309

  Fly   484 CGKSYSQQAYLNKHIQAHQMASAASASTSPGLLVAKQPHETLVCIVCGSLHADATALASHV 544
            |||.::...||..|::.|               ..::|   .:|..||..:.....|:.|:
Zfish   310 CGKHFTCNNYLTAHMRTH---------------TGERP---FICGQCGKSYCQRRNLSQHM 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 50/158 (32%)
C2H2 Zn finger 256..276 CDD:275368 5/19 (26%)
zf-H2C2_2 268..293 CDD:290200 8/24 (33%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
zf-H2C2_2 296..321 CDD:290200 13/24 (54%)
zf-C2H2_2 312..>387 CDD:289522 23/74 (31%)
C2H2 Zn finger 312..332 CDD:275368 7/19 (37%)
C2H2 Zn finger 340..360 CDD:275368 8/19 (42%)
C2H2 Zn finger 369..389 CDD:275368 6/19 (32%)
C2H2 Zn finger 397..417 CDD:275368 7/19 (37%)
zf-H2C2_2 409..434 CDD:290200 14/24 (58%)
C2H2 Zn finger 425..445 CDD:275368 8/19 (42%)
zf-H2C2_2 437..462 CDD:290200 14/24 (58%)
C2H2 Zn finger 453..473 CDD:275368 9/19 (47%)
zf-H2C2_2 465..490 CDD:290200 14/24 (58%)
C2H2 Zn finger 481..501 CDD:275368 8/19 (42%)
si:dkey-262g12.9XP_021331485.1 COG5048 <75..263 CDD:227381 66/202 (33%)
C2H2 Zn finger 83..103 CDD:275368 5/19 (26%)
C2H2 Zn finger 111..131 CDD:275368 7/19 (37%)
C2H2 Zn finger 139..159 CDD:275368 7/19 (37%)
C2H2 Zn finger 167..187 CDD:275368 8/19 (42%)
C2H2 Zn finger 195..215 CDD:275368 6/19 (32%)
COG5048 216..>328 CDD:227381 52/126 (41%)
C2H2 Zn finger 223..243 CDD:275368 7/19 (37%)
C2H2 Zn finger 251..271 CDD:275368 8/19 (42%)
C2H2 Zn finger 279..299 CDD:275368 9/19 (47%)
C2H2 Zn finger 307..327 CDD:275368 8/19 (42%)
C2H2 Zn finger 335..355 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.