DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12299 and CG10654

DIOPT Version :9

Sequence 1:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:433 Identity:94/433 - (21%)
Similarity:139/433 - (32%) Gaps:136/433 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PPDLTFH--CMCCAEFFVHPLALYQHMNTLHPHEPGNGQQEQESPGDESEDYSWIFEPVC----- 100
            ||.|...  |.||          ||.:...|.                       |:.:|     
  Fly    79 PPQLVLKSICECC----------YQLVQKFHD-----------------------FQRMCAESLR 110

  Fly   101 ---ELAEDGSDSSDGSASSGSDSSSSSDDDDDDDDDDSSSSSSSSSNSSSSSSSVPTTSNSNTQQ 162
               :|.:|            .|......:|....|.|:.|.|:.|:|..:.|.:....:   ||:
  Fly   111 NFEKLLQD------------IDIGCHKLEDHTWHDLDTPSESNESTNPEAQSHAPCIAA---TQE 160

  Fly   163 SQESVQP---------LHGLVAGPGYNEFQLQMTDPRESTSIFMVQPTVSVTPLQQLLPPAPTVS 218
            ....:.|         |..:..|....|....:.|  ||....:.|..:|::            |
  Fly   161 IVSFIWPQVCLPLAVILSRITLGASLEEEVYVIED--ESAKQDLGQEKLSIS------------S 211

  Fly   219 PGLGLQSTPIKRRRGRRSNIGAPVMDPALNGNQKCFQCTHCEASFPNAGDLSKHVRSHITNKPFQ 283
            ..||     .::|||.|..:                :|..|...|.....|..|::.|...:|:.
  Fly   212 KLLG-----ARKRRGVRHTL----------------ECRICHRGFYKPSLLEAHMQQHEGLRPYT 255

  Fly   284 CSICQKTFTHIGSLNTHIR-IHSGEKP----YKCELCPKAFTQSSSLMVHMRSHSVRKPHQCVQC 343
            |..|.|::.....|.:|:| :|:....    |.|..|.|.:|.:.||..|||.            
  Fly   256 CVHCAKSYARANLLESHLRQMHNNADAARIIYACPSCNKVYTANRSLKYHMRR------------ 308

  Fly   344 DKGFINYSSLLLHQKTH--IAPTETFICPECEREFKAEALLDEHMRMH--TQELVYQCAICREAF 404
                       .|::.|  .:|....||.||.:.|..:|.|..|..:|  .:...|.|..|...|
  Fly   309 -----------THERYHESESPDARHICEECGKCFARKAHLTRHKMVHGSVEGRRYCCECCDRRF 362

  Fly   405 RASSELVQHMKNHMGEKP--FTCSLCDRSFTQSGSLNIHMRIH 445
            .....:|.|:....|.|.  ..|..|.|.|..|..||.|.|.|
  Fly   363 YTKENMVDHLLRKHGNKNLLLRCRKCGRIFQNSVELNAHGRKH 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 41/167 (25%)
C2H2 Zn finger 256..276 CDD:275368 5/19 (26%)
zf-H2C2_2 268..293 CDD:290200 7/24 (29%)
C2H2 Zn finger 284..304 CDD:275368 6/20 (30%)
zf-H2C2_2 296..321 CDD:290200 8/29 (28%)
zf-C2H2_2 312..>387 CDD:289522 20/76 (26%)
C2H2 Zn finger 312..332 CDD:275368 9/19 (47%)
C2H2 Zn finger 340..360 CDD:275368 1/19 (5%)
C2H2 Zn finger 369..389 CDD:275368 7/19 (37%)
C2H2 Zn finger 397..417 CDD:275368 5/19 (26%)
zf-H2C2_2 409..434 CDD:290200 8/26 (31%)
C2H2 Zn finger 425..445 CDD:275368 9/19 (47%)
zf-H2C2_2 437..462 CDD:290200 5/9 (56%)
C2H2 Zn finger 453..473 CDD:275368
zf-H2C2_2 465..490 CDD:290200
C2H2 Zn finger 481..501 CDD:275368
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 11/68 (16%)
C2H2 Zn finger 228..248 CDD:275368 5/19 (26%)
C2H2 Zn finger 256..313 CDD:275368 18/79 (23%)
C2H2 Zn finger 289..314 CDD:275368 10/47 (21%)
zf-C2H2 323..345 CDD:278523 8/21 (38%)
C2H2 Zn finger 325..345 CDD:275368 7/19 (37%)
C2H2 Zn finger 355..376 CDD:275368 5/20 (25%)
C2H2 Zn finger 385..405 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.