DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12299 and Zkscan7

DIOPT Version :9

Sequence 1:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster
Sequence 2:XP_017451263.1 Gene:Zkscan7 / 363170 RGDID:1305242 Length:833 Species:Rattus norvegicus


Alignment Length:564 Identity:161/564 - (28%)
Similarity:242/564 - (42%) Gaps:107/564 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QTHLLPQQAPNPPQQQPQ-----------QPQPPDLTFHCMCCAEFFVHPLALYQHMNTLHPHEP 75
            |.||......:||.|:..           ..|.|.||..|....:..::|           |.:|
  Rat   294 QRHLSESGEVSPPVQEQDVHLKKMVALRATEQSPTLTSGCCSAPDDLLNP-----------PCDP 347

  Fly    76 G-------------NGQQEQE-----SPGDESEDYS-------WIFEP----VCE--LAE-DGSD 108
            |             .|..|..     |.|..|.|.|       .:.||    :||  ||: :|..
  Rat   348 GAHHFPSGHFGKNRMGSSEYSPKQGISKGSHSLDTSSGGLFGVALVEPESGDICEDPLAQVEGCP 412

  Fly   109 SSDGSASSGSDSSSSSDDDDDDDD--DDSSSSSSSSSNSSSSSSSVPTTSNSNTQQSQESVQPLH 171
            |.:||... ||....:|:.:...|  :||........:.||.:.........|:.|..|      
  Rat   413 SDEGSELE-SDFLEKNDEKNSTKDRIEDSKDVRERPESPSSPAEHQREAKRQNSYQCDE------ 470

  Fly   172 GLVAGPGYNEFQLQMTDPRESTSIFMVQPT----VSVTPLQ--QLLPPAPTVSPGLGLQSTPIKR 230
               .|..:|.....:...|..|.   .:|:    ...|.||  ||:....|.:     |..|.:.
  Rat   471 ---CGKIFNRSSHLLGHRRIHTG---ERPSECNECGKTFLQTSQLIVHLRTHT-----QEKPYEC 524

  Fly   231 RRGRRS--NIGAPVMDPALNGNQKCFQCTHC-----------------EASFPNAGDLS------ 270
            :...::  :....:....|:..:|.::...|                 .|..||..:.:      
  Rat   525 QESGKTYCHSSRLIQHQRLHNGEKPYKGNECVKASIQSSQLIDHKGAHAAEKPNESEEAFIWSKS 589

  Fly   271 -KHVRSHITNKPFQCSICQKTFTHIGSLNTHIRIHSGEKPYKCELCPKAFTQSSSLMVHMRSHSV 334
             :|...|.:.||::|:.|.|.|....:|..|.|||:|||||:|..|.|||::|..|..|...|:.
  Rat   590 LQHQVLHTSKKPYECNECGKAFCSNRNLTDHQRIHTGEKPYECIECGKAFSRSKCLTRHQSLHTG 654

  Fly   335 RKPHQCVQCDKGFINYSSLLLHQKTHIAPTETFICPECEREFKAEALLDEHMRMHTQELVYQCAI 399
            .||::|.:|.|.|...|.|:.|::.|.. .:.|.|.||.::|.....|..|.|:||.|..|:|:.
  Rat   655 EKPYKCSECGKAFSQNSQLIDHERIHTG-EKPFECSECGKKFSLSKCLIRHQRLHTGEKPYKCSE 718

  Fly   400 CREAFRASSELVQHMKNHMGEKPFTCSLCDRSFTQSGSLNIHMRIHTGEKPFQCKLCDKCFTQAS 464
            |.::|..:|.|:.|.:.|.||||:.|:.|.:.|:.|.||.:|.|.||||||::||.|.|.|..:|
  Rat   719 CGKSFNQNSHLIIHQRIHTGEKPYGCNECGKVFSYSSSLMVHQRTHTGEKPYKCKDCMKSFGDSS 783

  Fly   465 SLSVHMKIHAGEKPYPCPICGKSYSQQAYLNKHIQAHQMASAAS 508
            .|.||.::|.|||||.|..|||::||::..|.|.:.|.:...:|
  Rat   784 QLIVHQRVHTGEKPYECIECGKAFSQRSTFNHHQRTHNVEKPSS 827

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 58/182 (32%)
C2H2 Zn finger 256..276 CDD:275368 5/43 (12%)
zf-H2C2_2 268..293 CDD:290200 8/31 (26%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
zf-H2C2_2 296..321 CDD:290200 15/24 (63%)
zf-C2H2_2 312..>387 CDD:289522 26/74 (35%)
C2H2 Zn finger 312..332 CDD:275368 8/19 (42%)
C2H2 Zn finger 340..360 CDD:275368 7/19 (37%)
C2H2 Zn finger 369..389 CDD:275368 7/19 (37%)
C2H2 Zn finger 397..417 CDD:275368 6/19 (32%)
zf-H2C2_2 409..434 CDD:290200 10/24 (42%)
C2H2 Zn finger 425..445 CDD:275368 8/19 (42%)
zf-H2C2_2 437..462 CDD:290200 15/24 (63%)
C2H2 Zn finger 453..473 CDD:275368 9/19 (47%)
zf-H2C2_2 465..490 CDD:290200 13/24 (54%)
C2H2 Zn finger 481..501 CDD:275368 8/19 (42%)
Zkscan7XP_017451263.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.