DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12299 and GTF3A

DIOPT Version :9

Sequence 1:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster
Sequence 2:NP_002088.2 Gene:GTF3A / 2971 HGNCID:4662 Length:365 Species:Homo sapiens


Alignment Length:282 Identity:81/282 - (28%)
Similarity:116/282 - (41%) Gaps:59/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 PALNGNQKCFQCT--HCEASFPNAGDLSKHVRSHITNKPFQCSI--CQKTFTHIGSLNTHIRIHS 305
            |||   .:.|.|:  .|.|::..|..|..|:..|...:||.|..  |.|.|.....|:.||..|:
Human    34 PAL---PRRFICSFPDCSANYSKAWKLDAHLCKHTGERPFVCDYEGCGKAFIRDYHLSRHILTHT 95

  Fly   306 GEKPYKC----------------------------------ELCPKAFTQSSSLMVHMRSHSVRK 336
            ||||:.|                                  |.|.|.|.:...|.:|...|:...
Human    96 GEKPFVCAANGCDQKFNTKSNLKKHFERKHENQQKQYICSFEDCKKTFKKHQQLKIHQCQHTNEP 160

  Fly   337 PHQCVQ--CDKGFINYSSLLLHQKTHIAPTETFICPE-CEREFKAEALLDEHMR-MHTQELVYQC 397
            ..:|.|  |.|.|.:.|.|..|.|.|    |.::|.: |....|....|.:|:| .|.:|::  |
Human   161 LFKCTQEGCGKHFASPSKLKRHAKAH----EGYVCQKGCSFVAKTWTELLKHVRETHKEEIL--C 219

  Fly   398 AICREAFRASSELVQHMKNHMGEKPFTCSL----CDRSFTQSGSLNIH-MRIHTGEKPFQCKL-- 455
            .:||:.|:....|.||||.|..|:. .|..    |.|::|...:|..| :..|...:||.|:.  
Human   220 EVCRKTFKRKDYLKQHMKTHAPERD-VCRCPREGCGRTYTTVFNLQSHILSFHEESRPFVCEHAG 283

  Fly   456 CDKCFTQASSLSVHMKIHAGEK 477
            |.|.|....||:.|..:|..:|
Human   284 CGKTFAMKQSLTRHAVVHDPDK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 54/200 (27%)
C2H2 Zn finger 256..276 CDD:275368 6/21 (29%)
zf-H2C2_2 268..293 CDD:290200 9/26 (35%)
C2H2 Zn finger 284..304 CDD:275368 7/21 (33%)
zf-H2C2_2 296..321 CDD:290200 13/58 (22%)
zf-C2H2_2 312..>387 CDD:289522 24/111 (22%)
C2H2 Zn finger 312..332 CDD:275368 7/53 (13%)
C2H2 Zn finger 340..360 CDD:275368 9/21 (43%)
C2H2 Zn finger 369..389 CDD:275368 6/21 (29%)
C2H2 Zn finger 397..417 CDD:275368 9/19 (47%)
zf-H2C2_2 409..434 CDD:290200 10/28 (36%)
C2H2 Zn finger 425..445 CDD:275368 6/24 (25%)
zf-H2C2_2 437..462 CDD:290200 9/27 (33%)
C2H2 Zn finger 453..473 CDD:275368 7/21 (33%)
zf-H2C2_2 465..490 CDD:290200 5/13 (38%)
C2H2 Zn finger 481..501 CDD:275368
GTF3ANP_002088.2 zinc finger 42..64 6/21 (29%)
C2H2 Zn finger 45..64 CDD:275368 5/18 (28%)
COG5048 <64..187 CDD:227381 33/126 (26%)
zinc finger 72..94 7/21 (33%)
C2H2 Zn finger 72..94 CDD:275368 7/21 (33%)
zinc finger 102..125 1/22 (5%)
C2H2 Zn finger 102..120 CDD:275368 1/17 (6%)
zinc finger 134..156 6/21 (29%)
C2H2 Zn finger 137..156 CDD:275368 6/18 (33%)
zinc finger 164..186 9/21 (43%)
C2H2 Zn finger 164..186 CDD:275368 9/21 (43%)
zinc finger 191..213 6/21 (29%)
zinc finger 219..239 9/19 (47%)
C2H2 Zn finger 219..239 CDD:275368 9/19 (47%)
C2H2 Zn finger 246..271 CDD:275368 6/24 (25%)
zinc finger 248..271 5/22 (23%)
zinc finger 279..301 7/21 (33%)
C2H2 Zn finger 279..301 CDD:275368 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1498
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.