DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12299 and Zbtb44

DIOPT Version :9

Sequence 1:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster
Sequence 2:XP_006510278.1 Gene:Zbtb44 / 235132 MGIID:1925123 Length:616 Species:Mus musculus


Alignment Length:375 Identity:90/375 - (24%)
Similarity:142/375 - (37%) Gaps:102/375 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 QEQESPGDESEDYSWIF--------EPVCELAEDGSDSS----DGSASSG--------SDSSS-- 122
            :.:..|.|.|..:.|.|        :|  |.|:...::.    .|.:.:|        .:|:.  
Mouse   216 ENRSQPVDSSLAFPWTFPFGIDRRIQP--EKAKQAENTRTLELPGPSEAGRRVADYVTCESTKPT 278

  Fly   123 ---SSDDD---------DDDDDDDSSSSSSSSSNSSSSSSSVPTTSNSNTQQSQESVQPLHGLVA 175
               .:::|         |::..::.|...|:|.:|.|...:||         ..|.||  ..|:.
Mouse   279 LPLGTEEDVRVKVERLSDEEVHEEVSQPVSASQSSLSDQQTVP---------GSEPVQ--EDLLI 332

  Fly   176 GPGYNEFQLQMTDPRESTSIFMVQPTVSVTPLQQLLPPAPTVSPGLGLQSTPIKRRRG----RRS 236
            .|             :|:||..|...|:        ...||      ||||.......    |..
Mouse   333 SP-------------QSSSIGSVDEGVT--------EGLPT------LQSTSSTNAHADDDDRLE 370

  Fly   237 NIGAPVM-----------DPALNGNQKCFQCTHCEASFPNAGDLSKHVRSHITNKPFQCSICQKT 290
            |:..|..           .|:.||..:.|||..|...|....:|.:|:..|...|||||..|.|.
Mouse   371 NVQYPYQLYIAPSTSSTERPSPNGPDRPFQCPTCGVRFTRIQNLKQHMLIHSGIKPFQCDCCGKK 435

  Fly   291 FTHIGSLNTHIRIHSGEKPYKCELCPKAFTQSSSLMVHMR--SHSVRKP--HQCVQCDKGFINYS 351
            ||...||..|...|.|::.::|::|...||.......|||  .|.:|||  ::|..|...|.|..
Mouse   436 FTRAYSLKMHRLKHEGKRCFRCQICSATFTSFGEYKHHMRVSRHIIRKPRIYECKTCGAMFTNSG 500

  Fly   352 SLLLHQKT--HIA-------PTETFICPECEREFKAEALLDEHMRMHTQE 392
            :|::|.::  |.|       .:..|:.|:...:.:.|.|:...:..||.|
Mouse   501 NLIVHLRSLNHEASELANYFQSSDFLVPDYLNQEQEETLVQYDLGEHTFE 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 48/152 (32%)
C2H2 Zn finger 256..276 CDD:275368 5/19 (26%)
zf-H2C2_2 268..293 CDD:290200 11/24 (46%)
C2H2 Zn finger 284..304 CDD:275368 8/19 (42%)
zf-H2C2_2 296..321 CDD:290200 8/24 (33%)
zf-C2H2_2 312..>387 CDD:289522 23/87 (26%)
C2H2 Zn finger 312..332 CDD:275368 7/21 (33%)
C2H2 Zn finger 340..360 CDD:275368 6/21 (29%)
C2H2 Zn finger 369..389 CDD:275368 3/19 (16%)
C2H2 Zn finger 397..417 CDD:275368
zf-H2C2_2 409..434 CDD:290200
C2H2 Zn finger 425..445 CDD:275368
zf-H2C2_2 437..462 CDD:290200
C2H2 Zn finger 453..473 CDD:275368
zf-H2C2_2 465..490 CDD:290200
C2H2 Zn finger 481..501 CDD:275368
Zbtb44XP_006510278.1 BTB_POZ_ZBTB44 15..130 CDD:349537
zf-C2H2 399..421 CDD:333835 7/21 (33%)
C2H2 Zn finger 401..421 CDD:275368 5/19 (26%)
zf-H2C2_2 413..438 CDD:372612 11/24 (46%)
C2H2 Zn finger 429..449 CDD:275368 8/19 (42%)
C2H2 Zn finger 457..476 CDD:275368 6/18 (33%)
zf-C2H2 487..508 CDD:333835 6/20 (30%)
C2H2 Zn finger 489..511 CDD:275371 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.