DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12299 and ZBTB43

DIOPT Version :9

Sequence 1:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster
Sequence 2:NP_001129248.1 Gene:ZBTB43 / 23099 HGNCID:17908 Length:467 Species:Homo sapiens


Alignment Length:348 Identity:83/348 - (23%)
Similarity:135/348 - (38%) Gaps:85/348 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 RRSNIGAPVMDP---ALNGNQKCFQC-THCEASFPNAGDL----------SKHVRSHITNKPFQC 284
            ::.|.|:....|   :.||..:.|:. :.....||.|.:|          ...:.|.:|...:  
Human   132 QKLNHGSDHQSPSSSSYNGLVESFELGSGGHTDFPKAQELRDGENEEESTKDELSSQLTEHEY-- 194

  Fly   285 SICQKTFTHIGSLNTHIRIHSGEK--------PYKCELCPKAFTQSSSLMVHMRSHSVRKPHQCV 341
             :...:.|....|:|.:....||:        .|...:..|     .|:|.|.|...| ||.:..
Human   195 -LPSNSSTEHDRLSTEMASQDGEEGASDSAEFHYTRPMYSK-----PSIMAHKRWIHV-KPERLE 252

  Fly   342 QCDKGFINYSSLLLHQKT---HIAPTETFICPE-CEREF-----KAEALLDE------------- 384
            |..:|...:::...||.|   :...||..:.|. .|.:|     |.||..||             
Human   253 QACEGMDVHATYDEHQVTESINTVQTEHTVQPSGVEEDFHIGEKKVEAEFDEQADESNYDEQVDF 317

  Fly   385 ---------------HMRMHTQELVYQCAICREAFRASSELVQHMK---NHMG----EKPFTCSL 427
                           ::..|.||     |.....:..:.|:|..:|   :|:|    :|.:.|. 
Human   318 YGSSMEEFSGERSDGNLIGHRQE-----AALAAGYSENIEMVTGIKEEASHLGFSATDKLYPCQ- 376

  Fly   428 CDRSFTQSGSLNIHMRIHTGEKPFQCKLCDKCFTQASSLSVHMKIHAGEKPYPCPICGKSYSQQA 492
            |.:|||.....:.||.:|.|.:|:.|.:|.|.|.....|..|||||.|.|||.|.||.|.:..:.
Human   377 CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIHTGIKPYECNICAKRFMWRD 441

  Fly   493 YLNKHI----QAHQMASAASAST 511
            ..::|:    ::::.|.|...:|
Human   442 SFHRHVTSCTKSYEAAKAEQNTT 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 42/214 (20%)
C2H2 Zn finger 256..276 CDD:275368 4/30 (13%)
zf-H2C2_2 268..293 CDD:290200 3/34 (9%)
C2H2 Zn finger 284..304 CDD:275368 3/19 (16%)
zf-H2C2_2 296..321 CDD:290200 6/32 (19%)
zf-C2H2_2 312..>387 CDD:289522 23/111 (21%)
C2H2 Zn finger 312..332 CDD:275368 5/19 (26%)
C2H2 Zn finger 340..360 CDD:275368 5/22 (23%)
C2H2 Zn finger 369..389 CDD:275368 8/53 (15%)
C2H2 Zn finger 397..417 CDD:275368 4/22 (18%)
zf-H2C2_2 409..434 CDD:290200 10/31 (32%)
C2H2 Zn finger 425..445 CDD:275368 7/19 (37%)
zf-H2C2_2 437..462 CDD:290200 9/24 (38%)
C2H2 Zn finger 453..473 CDD:275368 8/19 (42%)
zf-H2C2_2 465..490 CDD:290200 14/24 (58%)
C2H2 Zn finger 481..501 CDD:275368 5/23 (22%)
ZBTB43NP_001129248.1 BTB_POZ_ZBTB43 8..128 CDD:349536
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..153 5/18 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..225 11/65 (17%)
C2H2 Zn finger 376..394 CDD:275368 6/18 (33%)
C2H2 Zn finger 402..422 CDD:275368 8/19 (42%)
zf-H2C2_2 414..437 CDD:404364 14/22 (64%)
C2H2 Zn finger 430..447 CDD:275368 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.