DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12299 and Zfp39

DIOPT Version :9

Sequence 1:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster
Sequence 2:NP_035888.2 Gene:Zfp39 / 22698 MGIID:99183 Length:718 Species:Mus musculus


Alignment Length:268 Identity:104/268 - (38%)
Similarity:156/268 - (58%) Gaps:4/268 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 RRSNIGAPVMDPALNGNQKCFQCTHCEASFPNAGDLSKHVRSHITNKPFQCSICQKTFTHIGSLN 298
            |:|::|   ....::..:|.:.|..|:.:|.:...|:.|.|:|...||::|..|:|||.....||
Mouse   420 RKSHLG---RHQKIHTGEKPYGCEECKKTFYHKSSLTIHQRTHTGEKPYECKKCRKTFYCKSDLN 481

  Fly   299 THIRIHSGEKPYKCELCPKAFTQSSSLMVHMRSHSVRKPHQCVQCDKGFINYSSLLLHQKTHIAP 363
            .|.|.|:|||||:|:.|.|.|...|.|::|.:.|:..||::|.:|.|.|...|:|.:|||||.. 
Mouse   482 VHHRTHTGEKPYECDECRKTFYSKSHLVIHQKVHTGDKPYECEECQKAFSRKSNLTVHQKTHTG- 545

  Fly   364 TETFICPECEREFKAEALLDEHMRMHTQELVYQCAICREAFRASSELVQHMKNHMGEKPFTCSLC 428
            .:.:.|..|.:.|..::.|:.|...||.:..|||..|.:||...|.|.:|.:||.|.:|:.|..|
Mouse   546 EKPYECNVCGKTFHRQSHLNMHQGTHTGQKPYQCEECGKAFYQKSSLRRHQRNHTGSRPYACEEC 610

  Fly   429 DRSFTQSGSLNIHMRIHTGEKPFQCKLCDKCFTQASSLSVHMKIHAGEKPYPCPICGKSYSQQAY 493
            .::|....||.:|.|.|||.||:.|:.|.|.|...|.|:||.:.|.|||||.|.:|.|::.|::|
Mouse   611 RKTFLHKSSLTVHQRSHTGYKPYSCEECRKTFYSKSHLTVHQRTHTGEKPYECKLCKKAFHQKSY 675

  Fly   494 LNKHIQAH 501
            ||:|...|
Mouse   676 LNRHQVTH 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 60/158 (38%)
C2H2 Zn finger 256..276 CDD:275368 6/19 (32%)
zf-H2C2_2 268..293 CDD:290200 11/24 (46%)
C2H2 Zn finger 284..304 CDD:275368 9/19 (47%)
zf-H2C2_2 296..321 CDD:290200 14/24 (58%)
zf-C2H2_2 312..>387 CDD:289522 26/74 (35%)
C2H2 Zn finger 312..332 CDD:275368 7/19 (37%)
C2H2 Zn finger 340..360 CDD:275368 9/19 (47%)
C2H2 Zn finger 369..389 CDD:275368 5/19 (26%)
C2H2 Zn finger 397..417 CDD:275368 7/19 (37%)
zf-H2C2_2 409..434 CDD:290200 9/24 (38%)
C2H2 Zn finger 425..445 CDD:275368 7/19 (37%)
zf-H2C2_2 437..462 CDD:290200 13/24 (54%)
C2H2 Zn finger 453..473 CDD:275368 8/19 (42%)
zf-H2C2_2 465..490 CDD:290200 12/24 (50%)
C2H2 Zn finger 481..501 CDD:275368 8/19 (42%)
Zfp39NP_035888.2 KRAB 59..118 CDD:214630
KRAB 59..98 CDD:279668
C2H2 Zn finger 300..320 CDD:275368
C2H2 Zn finger 328..347 CDD:275368
C2H2 Zn finger 355..374 CDD:275370
COG5048 407..699 CDD:227381 104/268 (39%)
C2H2 Zn finger 411..431 CDD:275368 3/13 (23%)
C2H2 Zn finger 439..459 CDD:275368 6/19 (32%)
zf-H2C2_2 451..474 CDD:290200 9/22 (41%)
C2H2 Zn finger 467..487 CDD:275368 9/19 (47%)
zf-H2C2_2 479..502 CDD:290200 13/22 (59%)
C2H2 Zn finger 495..515 CDD:275368 7/19 (37%)
zf-H2C2_2 507..532 CDD:290200 9/24 (38%)
C2H2 Zn finger 523..543 CDD:275368 9/19 (47%)
zf-H2C2_2 535..560 CDD:290200 9/25 (36%)
C2H2 Zn finger 551..571 CDD:275368 5/19 (26%)
zf-H2C2_2 563..586 CDD:290200 8/22 (36%)
C2H2 Zn finger 579..599 CDD:275368 7/19 (37%)
zf-H2C2_2 591..616 CDD:290200 9/24 (38%)
C2H2 Zn finger 607..627 CDD:275368 7/19 (37%)
C2H2 Zn finger 635..655 CDD:275368 8/19 (42%)
zf-H2C2_2 647..672 CDD:290200 12/24 (50%)
C2H2 Zn finger 663..683 CDD:275368 8/19 (42%)
C2H2 Zn finger 691..711 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.