DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12299 and C09F5.3

DIOPT Version :9

Sequence 1:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster
Sequence 2:NP_001367485.1 Gene:C09F5.3 / 182454 WormBaseID:WBGene00015649 Length:378 Species:Caenorhabditis elegans


Alignment Length:385 Identity:85/385 - (22%)
Similarity:146/385 - (37%) Gaps:84/385 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 STPIKR-RRGRRSNIGAPVMDPALNGNQKCFQCTHCEASFPNAGDLSKHVRS-HI---------- 277
            |:.:|: .|...|:..:|....::. .:...:|..|.....:...|..|..| |:          
 Worm    13 SSHVKQEERADDSHSNSPASSKSIK-QENLLKCELCSTVCSSISQLQSHTLSEHVPEKKPSISTS 76

  Fly   278 ----TNKPFQCSICQKTFTHIGSLNTHIRIHSG---EKPYKCELCP--KAFTQSSSLMVHMRSHS 333
                :.|...|..|:.||........|::.|..   .:.:.|.:||  ..|....|.:.|:.:..
 Worm    77 NSAPSTKRVACQQCEDTFEDFAQFAIHMKSHLSSVTSQLFFCPICPVGTPFRDKKSQLEHLTTQH 141

  Fly   334 VR---KPHQCVQCDKGFINYSSLLLHQKTHIAPT-ETFICPECEREFKAEALLDEHMRMHTQELV 394
            ::   ..|.|..||..|.:..:    |..|.|.. :.:.|..|:.|.:.|....||.:.|:::|:
 Worm   142 LQIQVTQHICSICDSAFPSPQA----QSVHFAEAHKKYSCTNCDFETENEKTFKEHSKQHSRQLI 202

  Fly   395 -YQCAICREAFRASSELVQHMKNHMGEKPF----------------------TCSLCDRSFTQSG 436
             |.||:|..::.:...|:.|::....::.|                      .||:||.|.....
 Worm   203 MYGCALCATSYPSQLHLITHVQMSHDQETFYPPSLPIPTPPSPKSTPKQRVLQCSVCDESVLGED 267

  Fly   437 SLNIH-MRIHTGEKPFQCKL--CDKC------FTQASSLSVHMKIHAGEKPYPCPICGKSYSQQA 492
            .|:.| :|.|       ||:  .|||      ....:|...|...|:.:..:.||:|.:|....:
 Worm   268 GLDEHRLRKH-------CKVRFADKCADCQEPLLNETSFVEHCLRHSKDHAHHCPVCRQSLRSDS 325

  Fly   493 YLNKHIQAH--QMASAASASTSP---GLLVAKQPHETLVCIVCGSLHADATALASH--VH 545
            .::.|...|  ...|.:|.|:||   |.        :.||.:||....|..||..|  :|
 Worm   326 QIHAHCAYHMSHQDSTSSTSSSPITNGF--------SFVCPICGEKLDDGFALIEHTKIH 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 40/183 (22%)
C2H2 Zn finger 256..276 CDD:275368 5/20 (25%)
zf-H2C2_2 268..293 CDD:290200 9/39 (23%)
C2H2 Zn finger 284..304 CDD:275368 5/19 (26%)
zf-H2C2_2 296..321 CDD:290200 6/29 (21%)
zf-C2H2_2 312..>387 CDD:289522 20/80 (25%)
C2H2 Zn finger 312..332 CDD:275368 6/21 (29%)
C2H2 Zn finger 340..360 CDD:275368 5/19 (26%)
C2H2 Zn finger 369..389 CDD:275368 6/19 (32%)
C2H2 Zn finger 397..417 CDD:275368 5/19 (26%)
zf-H2C2_2 409..434 CDD:290200 8/46 (17%)
C2H2 Zn finger 425..445 CDD:275368 8/20 (40%)
zf-H2C2_2 437..462 CDD:290200 9/33 (27%)
C2H2 Zn finger 453..473 CDD:275368 7/27 (26%)
zf-H2C2_2 465..490 CDD:290200 7/24 (29%)
C2H2 Zn finger 481..501 CDD:275368 5/19 (26%)
C09F5.3NP_001367485.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.