Sequence 1: | NP_609448.1 | Gene: | CG12299 / 34483 | FlyBaseID: | FBgn0032295 | Length: | 736 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509284.2 | Gene: | unc-98 / 181020 | WormBaseID: | WBGene00006827 | Length: | 310 | Species: | Caenorhabditis elegans |
Alignment Length: | 250 | Identity: | 68/250 - (27%) |
---|---|---|---|
Similarity: | 99/250 - (39%) | Gaps: | 52/250 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 214 APTVSPGLGLQS--TPIKRRRGRRSNIGAPVMDPALNGNQKCFQCTHCEASFPNAGDLSKHVRSH 276
Fly 277 ITNKP--------FQCSICQKTFTHIGSLNTHIRIHSGEKPYKCELCPKAFTQSSSLMVHMRSHS 333
Fly 334 VRKPHQCVQCDKGFINYSSLLLHQKTHIAPTETFICPECE--REFKAEALLDEHMRMHTQELVYQ 396
Fly 397 CAICREAFRASSELVQHMKNHMGEKPFTCSLCDRSFTQSGSLNIHMRIHTGEKPF 451 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12299 | NP_609448.1 | COG5048 | <254..413 | CDD:227381 | 40/168 (24%) |
C2H2 Zn finger | 256..276 | CDD:275368 | 2/19 (11%) | ||
zf-H2C2_2 | 268..293 | CDD:290200 | 7/32 (22%) | ||
C2H2 Zn finger | 284..304 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 296..321 | CDD:290200 | 10/24 (42%) | ||
zf-C2H2_2 | 312..>387 | CDD:289522 | 20/76 (26%) | ||
C2H2 Zn finger | 312..332 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 340..360 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 369..389 | CDD:275368 | 4/21 (19%) | ||
C2H2 Zn finger | 397..417 | CDD:275368 | 3/19 (16%) | ||
zf-H2C2_2 | 409..434 | CDD:290200 | 7/24 (29%) | ||
C2H2 Zn finger | 425..445 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 437..462 | CDD:290200 | 7/14 (50%) | ||
C2H2 Zn finger | 453..473 | CDD:275368 | |||
zf-H2C2_2 | 465..490 | CDD:290200 | |||
C2H2 Zn finger | 481..501 | CDD:275368 | |||
unc-98 | NP_509284.2 | C2H2 Zn finger | 115..135 | CDD:275368 | 7/19 (37%) |
C2H2 Zn finger | 143..163 | CDD:275368 | 5/19 (26%) | ||
SFP1 | <169..268 | CDD:227516 | 29/108 (27%) | ||
C2H2 Zn finger | 171..189 | CDD:275368 | 6/18 (33%) | ||
C2H2 Zn finger | 248..268 | CDD:275368 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24409 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |