DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12299 and egl-43

DIOPT Version :9

Sequence 1:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster
Sequence 2:NP_001022288.1 Gene:egl-43 / 174552 WormBaseID:WBGene00001207 Length:543 Species:Caenorhabditis elegans


Alignment Length:477 Identity:86/477 - (18%)
Similarity:147/477 - (30%) Gaps:225/477 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 CTHCEASFPNAGDLSKHVRSHITNKPFQ--------CSICQKTFTHIGSLNTHIRIHSGEKPYKC 312
            ||...:...|.....:::|.|....|.|        |.:|.|:|:....|..|..||...||::|
 Worm   125 CTKSSSEDSNLNGFEEYIREHGELVPGQTPPDGSHKCGVCPKSFSSASGLKQHSHIHCSLKPFRC 189

  Fly   313 ELCPKAFTQSSSLMVHMRSHSVRKPHQCVQCDKGFINYSSLLLHQKTHIAPTETFICPECEREFK 377
            .||||::||.|:|..|.|.||                               :.:.||.|:.:..
 Worm   190 HLCPKSYTQFSNLCRHRRVHS-------------------------------DGWTCPTCQSQMP 223

  Fly   378 AEALLDEH-----------------------------------MRMHTQELVYQCAICR---EAF 404
            ::|.|.:|                                   ::|.||...:..|...   ||:
 Worm   224 SQAALTKHRPVCEMTALYKPLMAQLAGLSGAGGLGSVPYWPHILQMATQAPHFPLAFLAANPEAY 288

  Fly   405 R---------------------------------------ASSELVQHMKNHMGE---------- 420
            :                                       ::||:....|:..||          
 Worm   289 KLMQQTTCASPDAECSSGHASESSPTTTEPVDLTATPKPPSTSEMETTSKSDDGEDRDSIGDSGN 353

  Fly   421 ----------------------KPFTCSLCD-RSFTQSG--------------SLNIH------- 441
                                  :|.:.::.| .:..|.|              |||.:       
 Worm   354 DDDDDSEAGVLDESSTTTSTKKRPTSHTISDILAAPQLGAQALNSTFLGMLQRSLNYNPAVPSPH 418

  Fly   442 --MRIHTGEKP--------------FQCKLCDKCFTQASSLSVHMKIHAGEKPYPCPICGKSYSQ 490
              :|..:|.|.              :.||.|.|.|.::::|:.|::.|.||:||.|..|.:|:|.
 Worm   419 SFLRAMSGAKASSSPSSSSGSGKDRYTCKFCQKVFPRSANLTRHLRTHTGEQPYKCQYCERSFSI 483

  Fly   491 QAYLNKHIQAHQMASAASASTSPGLLVAKQPHETLVCIVCGSLHADATALASHVHSQHAALLDTM 555
            .:.|.:|::.                :..:|:               |:|..|.|.:..:|.::.
 Worm   484 SSNLQRHVRN----------------IHNKPN---------------TSLTPHNHHRQRSLHNST 517

  Fly   556 KQSGMNTA--------PGGAIP 569
            ..|...|.        ||.::|
 Worm   518 STSTTTTTVHHPLLHLPGTSVP 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 44/241 (18%)
C2H2 Zn finger 256..276 CDD:275368 4/19 (21%)
zf-H2C2_2 268..293 CDD:290200 8/32 (25%)
C2H2 Zn finger 284..304 CDD:275368 6/19 (32%)
zf-H2C2_2 296..321 CDD:290200 11/24 (46%)
zf-C2H2_2 312..>387 CDD:289522 19/109 (17%)
C2H2 Zn finger 312..332 CDD:275368 11/19 (58%)
C2H2 Zn finger 340..360 CDD:275368 0/19 (0%)
C2H2 Zn finger 369..389 CDD:275368 6/54 (11%)
C2H2 Zn finger 397..417 CDD:275368 6/61 (10%)
zf-H2C2_2 409..434 CDD:290200 6/57 (11%)
C2H2 Zn finger 425..445 CDD:275368 7/43 (16%)
zf-H2C2_2 437..462 CDD:290200 11/47 (23%)
C2H2 Zn finger 453..473 CDD:275368 7/19 (37%)
zf-H2C2_2 465..490 CDD:290200 10/24 (42%)
C2H2 Zn finger 481..501 CDD:275368 6/19 (32%)
egl-43NP_001022288.1 SFP1 <115..210 CDD:227516 28/84 (33%)
C2H2 Zn finger 161..181 CDD:275368 6/19 (32%)
C2H2 Zn finger 189..209 CDD:275368 11/19 (58%)
C2H2 Zn finger 215..232 CDD:275368 5/16 (31%)
zf-C2H2 444..466 CDD:395048 7/21 (33%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
zf-H2C2_2 458..482 CDD:404364 10/23 (43%)
C2H2 Zn finger 474..495 CDD:275368 6/36 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.