DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12299 and ZNF787

DIOPT Version :9

Sequence 1:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster
Sequence 2:NP_001002836.2 Gene:ZNF787 / 126208 HGNCID:26998 Length:382 Species:Homo sapiens


Alignment Length:368 Identity:103/368 - (27%)
Similarity:142/368 - (38%) Gaps:79/368 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 GPGYNEFQLQMTDPRESTSIFMVQPTVSVTPLQQLLPPAPTVSPGLGLQSTPIKRRRGRRSNIGA 240
            ||..:|.|...:.......:.|....|...|..:|.||          ||.|             
Human    11 GPLDSEDQQMASHENPVDILIMDDDDVPSWPPTKLSPP----------QSAP------------- 52

  Fly   241 PVMDPALNGNQKCFQCTHCEASFPNAGDLSKHVRSHITNKPFQCSICQKTFTHIGSLNTHIRIHS 305
            |...|........:.|..|..||.:...|::|.|:|...:|..|:.|.|||:....|..|.|||:
Human    53 PAGPPPRPRPPAPYICNECGKSFSHWSKLTRHQRTHTGERPNACADCGKTFSQSSHLVQHRRIHT 117

  Fly   306 GEKPYKCELCPKAFTQSSSLMVHMRSHSVRKPHQCVQCDKGFINYSSLLLHQKTHIAPTETFICP 370
            |||||.|..|.|.|:.||:||.|.|.|:..||:.|..|.:.|....||..|:::| :..:.|:||
Human   118 GEKPYACLECGKRFSWSSNLMQHQRIHTGEKPYTCPDCGRSFTQSKSLAKHRRSH-SGLKPFVCP 181

  Fly   371 ECEREFKAEALLDEHMRMHTQ-------ELVYQCAICR-----EAFRASSELVQHMKNHMG---- 419
            .|.|.|.....|..|:|:|.:       ..|...::.|     ||..|..|:...:.:..|    
Human   182 RCGRGFSQPKSLARHLRLHPELSGPGVAAKVLAASVRRAKGPEEAVAADGEIAIPVGDGEGIIVV 246

  Fly   420 ------------------------------EKPFTCSLCDRSFTQSGSLNIHMRIH--------T 446
                                          .||:.|..|.:.|.....|..|.|..        .
Human   247 GAPGEGAAAAAAMAGAGAKAAGPRSRRAPAPKPYVCLECGKGFGHGAGLLAHQRAQHGDGLGAAG 311

  Fly   447 GEKPFQ-CKLCDKCFTQASSLSVHMKIHAGEKPYPCPICGKSY 488
            ||:|.. |..|.:.|.|.::|..|.||||...|..|..||:||
Human   312 GEEPAHICVECGEGFVQGAALRRHKKIHAVGAPSVCSSCGQSY 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 60/170 (35%)
C2H2 Zn finger 256..276 CDD:275368 7/19 (37%)
zf-H2C2_2 268..293 CDD:290200 10/24 (42%)
C2H2 Zn finger 284..304 CDD:275368 8/19 (42%)
zf-H2C2_2 296..321 CDD:290200 14/24 (58%)
zf-C2H2_2 312..>387 CDD:289522 28/74 (38%)
C2H2 Zn finger 312..332 CDD:275368 10/19 (53%)
C2H2 Zn finger 340..360 CDD:275368 6/19 (32%)
C2H2 Zn finger 369..389 CDD:275368 8/19 (42%)
C2H2 Zn finger 397..417 CDD:275368 5/24 (21%)
zf-H2C2_2 409..434 CDD:290200 7/58 (12%)
C2H2 Zn finger 425..445 CDD:275368 6/19 (32%)
zf-H2C2_2 437..462 CDD:290200 9/33 (27%)
C2H2 Zn finger 453..473 CDD:275368 7/19 (37%)
zf-H2C2_2 465..490 CDD:290200 12/24 (50%)
C2H2 Zn finger 481..501 CDD:275368 5/8 (63%)
ZNF787NP_001002836.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..65 15/76 (20%)
COG5048 <67..200 CDD:227381 53/133 (40%)
C2H2 Zn finger 68..88 CDD:275368 7/19 (37%)
C2H2 Zn finger 96..116 CDD:275368 8/19 (42%)
C2H2 Zn finger 124..144 CDD:275368 10/19 (53%)
C2H2 Zn finger 152..172 CDD:275368 6/19 (32%)
C2H2 Zn finger 180..200 CDD:275368 8/19 (42%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..382
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.