DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12299 and ZBTB18

DIOPT Version :9

Sequence 1:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster
Sequence 2:NP_991331.1 Gene:ZBTB18 / 10472 HGNCID:13030 Length:531 Species:Homo sapiens


Alignment Length:456 Identity:98/456 - (21%)
Similarity:163/456 - (35%) Gaps:136/456 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 VC--ELAEDGSDSSDGSASSGSDSSSSSDDDDDDDDDDSSSSSSSSSNSSSSSSSVPTTSNSNTQ 161
            ||  :|.|..:..:| |.....|:||.||           ...|.|..||..:..:|:..:....
Human   121 VCKKKLKEKATTEAD-STKKEEDASSCSD-----------KVESLSDGSSHIAGDLPSDEDEGED 173

  Fly   162 QSQESVQPLHGLVAGPGYNEFQLQMTDPRESTSIFMVQPTVSVTPLQQLLPPAPTVSPGLGLQST 226
            :....:.....|.|.||    .:.|..|.:|..|                       |..|.::.
Human   174 EKLNILPSKRDLAAEPG----NMWMRLPSDSAGI-----------------------PQAGGEAE 211

  Fly   227 PIKRRRGRRSNIGAPVMDPALNGNQKCFQCTHCEASFPNAGDLS-KHVRSHITNKPFQCSI---C 287
            |.....|:  .:.:|              |:..|:       || :.|.|...:....|.:   .
Human   212 PHATAAGK--TVASP--------------CSSTES-------LSQRSVTSVRDSADVDCVLDLSV 253

  Fly   288 QKTFTHIGSLNTHIRIHSGEKPYKCELCPKAFTQSSSLMVHMRSHSVRKPHQCVQCDKGFINY-- 350
            :.:.:.:.:||:                 ..|:....|..::....|.|...|.:.|.|..:|  
Human   254 KSSLSGVENLNS-----------------SYFSSQDVLRSNLVQVKVEKEASCDESDVGTNDYDM 301

  Fly   351 -----------SSLLLHQKTHIAP-TETFICPECEREFKAEALLDEHMRMHTQEL---------- 393
                       ::.:.::..|:|| .|..:..|.:||.||..  ||.|...::.:          
Human   302 EHSTVKESVSTNNRVQYEPAHLAPLREDSVLRELDREDKASD--DEMMTPESERVQVEGGMESSL 364

  Fly   394 -------------VYQCAICREAFRASSELVQHMKNHMGE------KPF------TCSLCDRSFT 433
                         ::.|.:|.:.|.:...|..|:..|..|      ||.      |||||.::|:
Human   365 LPYVSNILSPAGQIFMCPLCNKVFPSPHILQIHLSTHFREQDGIRSKPAADVNVPTCSLCGKTFS 429

  Fly   434 QSGSLNIHMRIHTGEKPFQCKLCDKCFTQASSLSVHMKIHAGEKPYPCPICGKSYSQQAYLNKHI 498
            ...:|..|.|.|:||||:.|..|.|.|..:.:||.|..:|..|||:.|..|.:.::|...|.:||
Human   430 CMYTLKRHERTHSGEKPYTCTQCGKSFQYSHNLSRHAVVHTREKPHACKWCERRFTQSGDLYRHI 494

  Fly   499 Q 499
            :
Human   495 R 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 33/199 (17%)
C2H2 Zn finger 256..276 CDD:275368 5/20 (25%)
zf-H2C2_2 268..293 CDD:290200 5/28 (18%)
C2H2 Zn finger 284..304 CDD:275368 3/22 (14%)
zf-H2C2_2 296..321 CDD:290200 3/24 (13%)
zf-C2H2_2 312..>387 CDD:289522 19/88 (22%)
C2H2 Zn finger 312..332 CDD:275368 2/19 (11%)
C2H2 Zn finger 340..360 CDD:275368 4/32 (13%)
C2H2 Zn finger 369..389 CDD:275368 8/19 (42%)
C2H2 Zn finger 397..417 CDD:275368 5/19 (26%)
zf-H2C2_2 409..434 CDD:290200 12/36 (33%)
C2H2 Zn finger 425..445 CDD:275368 8/19 (42%)
zf-H2C2_2 437..462 CDD:290200 12/24 (50%)
C2H2 Zn finger 453..473 CDD:275368 7/19 (37%)
zf-H2C2_2 465..490 CDD:290200 9/24 (38%)
C2H2 Zn finger 481..501 CDD:275368 6/19 (32%)
ZBTB18NP_991331.1 BTB 23..119 CDD:279045
BTB 34..119 CDD:197585
COG5048 <303..>490 CDD:227381 49/188 (26%)
C2H2 Zn finger 381..401 CDD:275368 5/19 (26%)
C2H2 Zn finger 421..441 CDD:275368 8/19 (42%)
zf-H2C2_2 434..456 CDD:290200 11/21 (52%)
C2H2 Zn finger 449..469 CDD:275368 7/19 (37%)
C2H2 Zn finger 477..495 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.