DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12299 and znf1034

DIOPT Version :9

Sequence 1:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster
Sequence 2:XP_017211154.1 Gene:znf1034 / 103910745 ZFINID:ZDB-GENE-120703-37 Length:512 Species:Danio rerio


Alignment Length:429 Identity:153/429 - (35%)
Similarity:218/429 - (50%) Gaps:31/429 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 LNGNQKCFQCTHCEASFPNAGDLSKHVRSHITNKPFQCSICQKTFTHIGSLNTHIRIHSGEKPYK 311
            ::..:|.|.||.|..||..:.:|::|:|.|...|||.|:.|.|:|:...|||.|||||:||||:.
Zfish    30 IHTGEKPFTCTQCWKSFSRSSELNQHMRIHTEEKPFTCTQCGKSFSCSSSLNKHIRIHTGEKPFT 94

  Fly   312 CELCPKAFTQSSSLMVHMRSHSVRKPHQCVQCDKGFINYSSLLLHQKTHIAPTETFICPECEREF 376
            |..|.|:|.:||.|..|||.|:..||..|.||.|.|...|.|..|.:.|.. .:.|.|.:|.:.|
Zfish    95 CTQCGKSFGRSSYLNQHMRIHTGEKPFTCTQCGKIFGRSSYLNQHMRIHTG-EKLFTCTQCGKSF 158

  Fly   377 KAEALLDEHMRMHTQELVYQCAICREAFRASSELVQHMKNHMGEKPFTCSLCDRSFTQSGSLNIH 441
            ...:.|::|||:||.|..:.|..|.:.|..||.|.|||:.|.|||||||:.|.:||:.|.:||.|
Zfish   159 GRSSHLNQHMRIHTGEKPFTCTQCGKNFNQSSHLNQHMRIHTGEKPFTCTQCGKSFSYSANLNQH 223

  Fly   442 MRIHTGEKPFQCKLCDKCFTQASSLSVHMKIHAGEKPYPCPICGKSYSQQAYLNKHIQAHQ---- 502
            ||||||||||.|..|.|.|:.:::|:.||:||.||||:.|..||||:||.:|||:|::.|.    
Zfish   224 MRIHTGEKPFTCTQCGKSFSNSANLNQHMRIHTGEKPFTCTQCGKSFSQSSYLNQHMRIHTGEKP 288

  Fly   503 ---MASAASASTSPGLLVAKQPH---ETLVCIVCGSLHADATALASHVHSQHAALLDTMKQSGMN 561
               .....|.|.||.|....:.|   :...|..||...:.:::|..|:.........|..|.|.:
Zfish   289 FTCSQCGKSFSQSPYLNQHMRIHTGEKPFTCSQCGKSFSQSSSLYLHMRIHTGEKPFTCTQCGKS 353

  Fly   562 TAPGGAIPDVKCSAEEQQAYVERVQC--VLQQMNHQQQHQQ-HQQQPP---------QQQQQHPQ 614
            .:....: ::.......:.....:||  ...|......|.: |..:.|         ..|..:|.
Zfish   354 FSKSSNL-NIHMRNHTGEKPFTCLQCGKSFSQSTSLNLHMRIHTGEKPFTCTQCGKSFSQSSNPN 417

  Fly   615 QQQQQHLQQQPH-----QMQLPQQPKL--PAMDSTGEDE 646
            ...:.|:.::|.     :....|...|  ..|..|||.|
Zfish   418 IHMRNHIGEKPFTCTQCEKSFSQSTSLNRQMMIHTGEKE 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 68/158 (43%)
C2H2 Zn finger 256..276 CDD:275368 8/19 (42%)
zf-H2C2_2 268..293 CDD:290200 11/24 (46%)
C2H2 Zn finger 284..304 CDD:275368 10/19 (53%)
zf-H2C2_2 296..321 CDD:290200 16/24 (67%)
zf-C2H2_2 312..>387 CDD:289522 28/74 (38%)
C2H2 Zn finger 312..332 CDD:275368 10/19 (53%)
C2H2 Zn finger 340..360 CDD:275368 8/19 (42%)
C2H2 Zn finger 369..389 CDD:275368 7/19 (37%)
C2H2 Zn finger 397..417 CDD:275368 9/19 (47%)
zf-H2C2_2 409..434 CDD:290200 15/24 (63%)
C2H2 Zn finger 425..445 CDD:275368 10/19 (53%)
zf-H2C2_2 437..462 CDD:290200 17/24 (71%)
C2H2 Zn finger 453..473 CDD:275368 7/19 (37%)
zf-H2C2_2 465..490 CDD:290200 14/24 (58%)
C2H2 Zn finger 481..501 CDD:275368 11/19 (58%)
znf1034XP_017211154.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.