DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12299 and LOC101882575

DIOPT Version :9

Sequence 1:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster
Sequence 2:XP_021326494.1 Gene:LOC101882575 / 101882575 -ID:- Length:346 Species:Danio rerio


Alignment Length:223 Identity:88/223 - (39%)
Similarity:128/223 - (57%) Gaps:1/223 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 CSICQKTFTHIGSLNTHIRIHSGEKPYKCELCPKAFTQSSSLMVHMRSHSVRKPHQCVQCDKGFI 348
            |..|.|:||...|...|:|:|:|.|||.|..|.|:||...:|.:||..|:..|||.|:.|:|.||
Zfish   125 CHECGKSFTRKQSFTKHMRVHTGAKPYTCSQCGKSFTWKQNLTMHMMIHTGEKPHACLYCEKSFI 189

  Fly   349 NYSSLLLHQKTHIAPTETFICPECEREFKAEALLDEHMRMHTQELVYQCAICREAFRASSELVQH 413
            :..||..|.:.|.. .:...|.:|.:.|..:..|.:|||:||.|..:.|..|.::|..:.....|
Zfish   190 SKQSLTNHMEVHTG-GKPHTCHQCGKSFTWKQYLTQHMRIHTGEKPHSCQQCGKSFTWTQSYRNH 253

  Fly   414 MKNHMGEKPFTCSLCDRSFTQSGSLNIHMRIHTGEKPFQCKLCDKCFTQASSLSVHMKIHAGEKP 478
            |:||..|:|:.|..|.:||....:|..||..|||||.:.|:.|.|.||...||:.|:|||:|.||
Zfish   254 MRNHTKERPYVCQQCGKSFIWKQNLKNHMNAHTGEKLYSCQYCGKSFTWKQSLTDHLKIHSGVKP 318

  Fly   479 YPCPICGKSYSQQAYLNKHIQAHQMASA 506
            :.||.||||:..:..|.:|::.|...::
Zfish   319 HSCPQCGKSFIWKQNLIEHMKVHSRCAS 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 47/128 (37%)
C2H2 Zn finger 256..276 CDD:275368
zf-H2C2_2 268..293 CDD:290200 4/8 (50%)
C2H2 Zn finger 284..304 CDD:275368 8/19 (42%)
zf-H2C2_2 296..321 CDD:290200 12/24 (50%)
zf-C2H2_2 312..>387 CDD:289522 26/74 (35%)
C2H2 Zn finger 312..332 CDD:275368 8/19 (42%)
C2H2 Zn finger 340..360 CDD:275368 8/19 (42%)
C2H2 Zn finger 369..389 CDD:275368 7/19 (37%)
C2H2 Zn finger 397..417 CDD:275368 5/19 (26%)
zf-H2C2_2 409..434 CDD:290200 10/24 (42%)
C2H2 Zn finger 425..445 CDD:275368 7/19 (37%)
zf-H2C2_2 437..462 CDD:290200 12/24 (50%)
C2H2 Zn finger 453..473 CDD:275368 9/19 (47%)
zf-H2C2_2 465..490 CDD:290200 15/24 (63%)
C2H2 Zn finger 481..501 CDD:275368 8/19 (42%)
LOC101882575XP_021326494.1 COG5048 <74..272 CDD:227381 55/147 (37%)
C2H2 Zn finger 125..145 CDD:275368 8/19 (42%)
C2H2 Zn finger 153..173 CDD:275368 8/19 (42%)
C2H2 Zn finger 181..201 CDD:275368 8/19 (42%)
C2H2 Zn finger 209..229 CDD:275368 7/19 (37%)
C2H2 Zn finger 237..257 CDD:275368 5/19 (26%)
C2H2 Zn finger 265..285 CDD:275368 7/19 (37%)
C2H2 Zn finger 293..313 CDD:275368 9/19 (47%)
C2H2 Zn finger 321..341 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.