DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12299 and zbtb34

DIOPT Version :9

Sequence 1:	NP_609448.1	Gene:	CG12299 / 34483	FlyBaseID:	FBgn0032295	Length:	736	Species:	Drosophila melanogaster
Sequence 2:	NP_001116183.1	Gene:	zbtb34 / 100004439	ZFINID:	ZDB-GENE-050624-2	Length:	508	Species:	Danio rerio

Alignment Length:	163	Identity:	51/163 - (31%)
Similarity:	71/163 - (43%)	Gaps:	30/163 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   425 CSLCDRSFTQSGSLNIHMRIHTGEKPFQCKLCDKCFTQASSLSVHMKIHAGEKPYPCPICGKSYS 489
            |..|.:||.|.|||:.|||:|.|..||.||.|.|.:|:...|..|::.|...||:.|.||||.:.
Zfish   362 CIYCGKSFNQKGSLDRHMRLHMGITPFVCKFCGKKYTRKDQLEYHIRGHTDNKPFHCQICGKCFP 426

  Fly   490 QQAYLNKHIQAHQMASAASASTSPGLLV-------AKQPHETLVCIVCGSLHADATALASHVHSQ 547
            .|..||:|::...|.|....:....||.       .:|...:.....||:.:.|..:..|
Zfish   427 FQGTLNQHLRKKHMTSGTEINNHTDLLEEAPDGQRGEQEDISEGEAACGAAYPDDLSKKS----- 486

  Fly   548 HAALLDTMKQSGMNTAPGGAIPDVKCSAEEQQA 580
                  ..::||            |||.||..|
Zfish   487 ------PSEESG------------KCSPEEPPA 501

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12299	NP_609448.1	COG5048	<254..413	CDD:227381
		C2H2 Zn finger	256..276	CDD:275368
		zf-H2C2_2	268..293	CDD:290200
		C2H2 Zn finger	284..304	CDD:275368
		zf-H2C2_2	296..321	CDD:290200
		zf-C2H2_2	312..>387	CDD:289522
		C2H2 Zn finger	312..332	CDD:275368
		C2H2 Zn finger	340..360	CDD:275368
		C2H2 Zn finger	369..389	CDD:275368
		C2H2 Zn finger	397..417	CDD:275368
		zf-H2C2_2	409..434	CDD:290200	4/8 (50%)
		C2H2 Zn finger	425..445	CDD:275368	11/19 (58%)
		zf-H2C2_2	437..462	CDD:290200	13/24 (54%)
		C2H2 Zn finger	453..473	CDD:275368	7/19 (37%)
		zf-H2C2_2	465..490	CDD:290200	10/24 (42%)
		C2H2 Zn finger	481..501	CDD:275368	9/19 (47%)
zbtb34	NP_001116183.1	BTB	23..123	CDD:279045
		BTB	34..124	CDD:197585
		CENP_C_N	<181..>267	CDD:292255
		ZnF_C2H2	360..382	CDD:197676	11/19 (58%)
		C2H2 Zn finger	362..382	CDD:275368	11/19 (58%)
		zf-H2C2_2	374..399	CDD:290200	13/24 (54%)
		C2H2 Zn finger	390..410	CDD:275368	7/19 (37%)
		zf-H2C2_2	403..425	CDD:290200	10/21 (48%)
		C2H2 Zn finger	418..436	CDD:275368	9/17 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	0	0.000