DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-5 and VMA3

DIOPT Version :9

Sequence 1:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_010887.3 Gene:VMA3 / 856686 SGDID:S000000753 Length:160 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:92/147 - (62%)
Similarity:115/147 - (78%) Gaps:2/147 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PPYSPFYGVMGVVFSSVLTSAGAAYGTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAIYGLVV 105
            |.|:||:|.:|...:.:.||.|||||||.||.||.||.|:||:|:.|:|:||:||||||||||||
Yeast     6 PVYAPFFGAIGCASAIIFTSLGAAYGTAKSGVGICATCVLRPDLLFKNIVPVIMAGIIAIYGLVV 70

  Fly   106 SVLLSGELAPAPKYSLPTGYVHLAAGLSVGFAGLAAGYAVGEVGEVGVRHIALQPRLFIGMILIL 170
            |||:...|  ..|.:|.||::.|.||||||.:|||||:|:|.||:.|||..:.|||||:||||||
Yeast    71 SVLVCYSL--GQKQALYTGFIQLGAGLSVGLSGLAAGFAIGIVGDAGVRGSSQQPRLFVGMILIL 133

  Fly   171 IFAEVLGLYGLIIGIYL 187
            ||||||||||||:.:.|
Yeast   134 IFAEVLGLYGLIVALLL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 62/106 (58%)
ATP-synt_C 127..187 CDD:278563 42/59 (71%)
VMA3NP_010887.3 V_ATP_synt_C 11..116 CDD:130170 62/106 (58%)
ATP-synt_Vo_c_ATP6C_rpt2 84..151 CDD:349416 46/67 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342239
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S170
OMA 1 1.010 - - QHG53914
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
TreeFam 1 0.960 - -
98.760

Return to query results.
Submit another query.