DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-5 and VMA16

DIOPT Version :9

Sequence 1:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_011891.1 Gene:VMA16 / 856421 SGDID:S000001068 Length:213 Species:Saccharomyces cerevisiae


Alignment Length:155 Identity:50/155 - (32%)
Similarity:84/155 - (54%) Gaps:8/155 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RYPPYSPFYGVMGVVFSSVLTSAGAAYGTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAIYGL 103
            |..||  .:..:|:.....|:..|||:|..::|:.:....|..|.:..|::|.::...::|||||
Yeast    53 RTSPY--MWANLGIALCVGLSVVGAAWGIFITGSSMIGAGVRAPRITTKNLISIIFCEVVAIYGL 115

  Fly   104 VVSVLLSGELAPA------PKYSLPTGYVHLAAGLSVGFAGLAAGYAVGEVGEVGVRHIALQPRL 162
            :::::.|.:|..|      .|.:|.|||....||::||.:.|..|.|||..|.......|....|
Yeast   116 IIAIVFSSKLTVATAENMYSKSNLYTGYSLFWAGITVGASNLICGIAVGITGATAAISDAADSAL 180

  Fly   163 FIGMILILIFAEVLGLYGLIIGIYL 187
            |:.:::|.||..:|||.|||:|:.:
Yeast   181 FVKILVIEIFGSILGLLGLIVGLLM 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 34/112 (30%)
ATP-synt_C 127..187 CDD:278563 23/59 (39%)
VMA16NP_011891.1 ATP-synt_Vo_c_ATP6F_rpt1 59..121 CDD:349417 16/61 (26%)
ATP-synt_Vo_c_ATP6F_rpt2 141..>192 CDD:349418 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.