DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-5 and VMA11

DIOPT Version :9

Sequence 1:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_015090.1 Gene:VMA11 / 855842 SGDID:S000006155 Length:164 Species:Saccharomyces cerevisiae


Alignment Length:149 Identity:87/149 - (58%)
Similarity:115/149 - (77%) Gaps:0/149 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PPYSPFYGVMGVVFSSVLTSAGAAYGTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAIYGLVV 105
            |.|:||:|..|...:.||:..|||.|||.||.|||.....:|||:|||:|||||:||:|||||||
Yeast    12 PLYAPFFGFAGCAAAMVLSCLGAAIGTAKSGIGIAGIGTFKPELIMKSLIPVVMSGILAIYGLVV 76

  Fly   106 SVLLSGELAPAPKYSLPTGYVHLAAGLSVGFAGLAAGYAVGEVGEVGVRHIALQPRLFIGMILIL 170
            :||::|.|:|...|:|..|::||:.||.||||.|::|||:|.||:||||....|||||:|::|||
Yeast    77 AVLIAGNLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGMVGDVGVRKYMHQPRLFVGIVLIL 141

  Fly   171 IFAEVLGLYGLIIGIYLYT 189
            ||:|||||||:|:.:.|.|
Yeast   142 IFSEVLGLYGMIVALILNT 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 60/106 (57%)
ATP-synt_C 127..187 CDD:278563 38/59 (64%)
VMA11NP_015090.1 ATP-synt_C 17..124 CDD:412393 60/106 (57%)
ATP-synt_Vo_c_ATP6C_rpt2 92..159 CDD:349416 40/66 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113185
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S170
OMA 1 1.010 - - QHG53914
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.