DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-5 and AVA-P4

DIOPT Version :9

Sequence 1:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001185404.1 Gene:AVA-P4 / 843898 AraportID:AT1G75630 Length:200 Species:Arabidopsis thaliana


Alignment Length:179 Identity:86/179 - (48%)
Similarity:112/179 - (62%) Gaps:35/179 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SPFYGVMGVVFSSVLTSAGAAYGTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAIYGLVVSVL 108
            :||:|.:|...:.|.:..|||||||.||.|:|:..|||||||||||:||||||::.||||:::|:
plant    12 APFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVI 76

  Fly   109 LSGELAP-APKYSLPTGYVHLAAGLSVGFAGLAAGYAVGEVGEVGVRHI---------------- 156
            :|..:.| |..|.|..||.||::||:.|.|||:||.|:|.||:.|||.:                
plant    77 ISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRVVDCNPDSKIKIYSFTTS 141

  Fly   157 ------------------ALQPRLFIGMILILIFAEVLGLYGLIIGIYL 187
                              |.||:||:||||||||||.|.|||||:||.|
plant   142 FLSNLSQKELFIDLLSANAQQPKLFVGMILILIFAEALALYGLIVGIIL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 58/107 (54%)
ATP-synt_C 127..187 CDD:278563 40/93 (43%)
AVA-P4NP_001185404.1 V_ATP_synt_C 14..122 CDD:130170 58/107 (54%)
ATP-synt_C 95..191 CDD:278563 41/96 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2684
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H113185
Inparanoid 1 1.050 200 1.000 Inparanoid score I1314
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - mtm8409
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X666
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.