DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-5 and Atp5g2

DIOPT Version :9

Sequence 1:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_080744.1 Gene:Atp5g2 / 67942 MGIID:1915192 Length:146 Species:Mus musculus


Alignment Length:189 Identity:44/189 - (23%)
Similarity:69/189 - (36%) Gaps:57/189 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VYNGSNSVDVPGLIESLKLKETS------ISPIVLDRYPPYSPFYGVMGVVFSSVLTSAGAAYGT 67
            :|..|..|....||.|..|:.||      :|.:.|.|  |..|                      
Mouse     1 MYACSKFVSTRSLIRSTSLRSTSQLLSRPLSAVELKR--PQMP---------------------- 41

  Fly    68 AVSGTGIAATAVMRPELVMKSIIPVVMAGIIAIYGLVVSVLLSGELAPAPKY----SLPTGYVHL 128
              :...:::.||.||   :.|:||.......||         |.::..|.|:    :...|....
Mouse    42 --TDESLSSLAVRRP---LTSLIPSRSFQTSAI---------SRDIDTAAKFIGAGAATVGVAGS 92

  Fly   129 AAGLSVGFAGLAAGYAVGEVGEVGVRHIALQPRLFIGMILILIFAEVLGLYGLIIGIYL 187
            .||:...|..|..|||         |:.:|:.:||...||....:|.:||:.|::...:
Mouse    93 GAGIGTVFGSLIIGYA---------RNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 20/110 (18%)
ATP-synt_C 127..187 CDD:278563 17/59 (29%)
Atp5g2NP_080744.1 ATP9 72..146 CDD:164765 20/80 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.