DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-5 and VhaPPA1-1

DIOPT Version :9

Sequence 1:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001247111.1 Gene:VhaPPA1-1 / 45247 FlyBaseID:FBgn0028662 Length:212 Species:Drosophila melanogaster


Alignment Length:160 Identity:55/160 - (34%)
Similarity:84/160 - (52%) Gaps:19/160 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PYSPFYGVMGVVFSSVLTSAGAAYGTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAIYGLVVS 106
            ||  .:..:|:..|..|:..|||.|...:||.|....|..|.:..|::|.|:....:|||||:.:
  Fly    48 PY--MWACLGIGLSVSLSVVGAALGIHTTGTSIVGGGVKAPRIKTKNLISVIFCEAVAIYGLITA 110

  Fly   107 VLLSGELAPAPKYSLPT--------------GYVHLAAGLSVGFAGLAAGYAVGEVGEVGVRHIA 157
            ::|||:|   .::|:.|              ||:...|||:||...|..|.|||.||.......|
  Fly   111 IVLSGQL---EQFSMETALSQAAIQNTNWFSGYLIFGAGLAVGLVNLFCGIAVGIVGSGAALSDA 172

  Fly   158 LQPRLFIGMILILIFAEVLGLYGLIIGIYL 187
            ....||:.::::.||...:||:|||:|||:
  Fly   173 ANAALFVKILIVEIFGSAIGLFGLIVGIYM 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 40/120 (33%)
ATP-synt_C 127..187 CDD:278563 24/59 (41%)
VhaPPA1-1NP_001247111.1 ATP-synt_Vo_c_ATP6F_rpt1 51..113 CDD:349417 20/61 (33%)
ATP-synt_Vo_c_ATP6F_rpt2 138..202 CDD:349418 26/63 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453376
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.