DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-5 and atp6v0c

DIOPT Version :9

Sequence 1:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_988893.1 Gene:atp6v0c / 394488 XenbaseID:XB-GENE-981790 Length:156 Species:Xenopus tropicalis


Alignment Length:149 Identity:97/149 - (65%)
Similarity:117/149 - (78%) Gaps:2/149 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PPYSPFYGVMGVVFSSVLTSAGAAYGTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAIYGLVV 105
            |.||.|:.|||...:.|.::.|||||||.|||||||.:||||||:||||||||||||||||||||
 Frog     9 PEYSAFFAVMGASSAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVV 73

  Fly   106 SVLLSGELAPAPKYSLPTGYVHLAAGLSVGFAGLAAGYAVGEVGEVGVRHIALQPRLFIGMILIL 170
            :||::..|..:  .:|...::.|.||||||.:|||||:|:|.||:.|||..|.|||||:||||||
 Frog    74 AVLIANSLTSS--ITLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILIL 136

  Fly   171 IFAEVLGLYGLIIGIYLYT 189
            ||||||||||||:.:.|.|
 Frog   137 IFAEVLGLYGLIVALILST 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 65/106 (61%)
ATP-synt_C 127..187 CDD:278563 43/59 (73%)
atp6v0cNP_988893.1 V_ATP_synt_C 14..119 CDD:130170 65/106 (61%)
ATP-synt_Vo_c_ATP6C_rpt2 87..154 CDD:349416 44/66 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10263
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.