DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-5 and Vha16-2

DIOPT Version :9

Sequence 1:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_729707.1 Gene:Vha16-2 / 39282 FlyBaseID:FBgn0028668 Length:158 Species:Drosophila melanogaster


Alignment Length:153 Identity:94/153 - (61%)
Similarity:114/153 - (74%) Gaps:2/153 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LDRYPPYSPFYGVMGVVFSSVLTSAGAAYGTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAIY 101
            |:..|.|:.|.|..|...:.:.|:.||:|||||||.|||..||.||:::||:|||||||||||||
  Fly     6 LNEEPSYAFFLGCTGAAVAIIFTTLGASYGTAVSGVGIAKMAVNRPDMIMKAIIPVVMAGIIAIY 70

  Fly   102 GLVVSVLLSGELAPAPKYSLPTGYVHLAAGLSVGFAGLAAGYAVGEVGEVGVRHIALQPRLFIGM 166
            |||||||::|.:  ...|::...||||.||||||..||.||.|:|..|:.|||..|.|||||:||
  Fly    71 GLVVSVLIAGSI--GDDYTMEDSYVHLGAGLSVGLPGLTAGVAIGIAGDAGVRGTAEQPRLFVGM 133

  Fly   167 ILILIFAEVLGLYGLIIGIYLYT 189
            :|||||||||.|||||:.|||||
  Fly   134 VLILIFAEVLALYGLIVAIYLYT 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 61/106 (58%)
ATP-synt_C 127..187 CDD:278563 41/59 (69%)
Vha16-2NP_729707.1 PRK06558 14..158 CDD:235830 91/145 (63%)
ATP-synt_C 15..120 CDD:294318 61/106 (58%)
ATP-synt_C 94..154 CDD:278563 41/59 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444253
Domainoid 1 1.000 89 1.000 Domainoid score I2684
eggNOG 1 0.900 - - E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1314
Isobase 1 0.950 - 0 Normalized mean entropy S170
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - mtm8409
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
1110.850

Return to query results.
Submit another query.