DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-5 and atp6v0b

DIOPT Version :9

Sequence 1:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_955855.2 Gene:atp6v0b / 321724 ZFINID:ZDB-GENE-030131-443 Length:206 Species:Danio rerio


Alignment Length:161 Identity:48/161 - (29%)
Similarity:84/161 - (52%) Gaps:14/161 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SPF-YGVMGVVFSSVLTSAGAAYGTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAIYGLVVSV 107
            ||| :..:|:..:..|:..|||:|..::|:.|....|..|.:..|:::.::....:||||:::::
Zfish    46 SPFMWANLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAI 110

  Fly   108 LLSG----------ELAPAPKYSLPTGYVHLAAGLSVGFAGLAAGYAVGEVGEVGVRHIALQPRL 162
            ::|.          |...:..|.  .||....|||:|||:.|..|..||.||.......|....|
Zfish   111 VISNLAENFSGTTPETIGSKNYQ--AGYSMFGAGLTVGFSNLFCGICVGIVGSGAALADAQNANL 173

  Fly   163 FIGMILILIFAEVLGLYGLIIGIYLYTVNIK 193
            |:.::::.||...:||:|:|:.| |.|..:|
Zfish   174 FVRILIVEIFGSAIGLFGVIVAI-LQTSKVK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 33/117 (28%)
ATP-synt_C 127..187 CDD:278563 22/59 (37%)
atp6v0bNP_955855.2 PRK08344 49..200 CDD:236246 43/153 (28%)
ATP-synt_C 51..113 CDD:278563 15/61 (25%)
ATP-synt_C 137..197 CDD:278563 22/60 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.