DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-5 and vma3

DIOPT Version :9

Sequence 1:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_594799.1 Gene:vma3 / 2542471 PomBaseID:SPAC1B3.14 Length:161 Species:Schizosaccharomyces pombe


Alignment Length:152 Identity:97/152 - (63%)
Similarity:117/152 - (76%) Gaps:2/152 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DRYPPYSPFYGVMGVVFSSVLTSAGAAYGTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAIYG 102
            |..|.|:||:||||...:.|..|.|||||||.:|.||:|..|:||:|::|:.|||||||||||||
pombe     4 DLCPVYAPFFGVMGCTAAIVFASFGAAYGTAKAGVGISAMGVLRPDLIVKNTIPVVMAGIIAIYG 68

  Fly   103 LVVSVLLSGELAPAPKYSLPTGYVHLAAGLSVGFAGLAAGYAVGEVGEVGVRHIALQPRLFIGMI 167
            ||||||:||.|...  .||.:|::.|.||||||.||||||:|:|.||:.|||..|.|||||:.||
pombe    69 LVVSVLISGNLKQI--LSLYSGFIQLGAGLSVGLAGLAAGFAIGIVGDAGVRGTAQQPRLFVAMI 131

  Fly   168 LILIFAEVLGLYGLIIGIYLYT 189
            |||||||||||||||:.:.|.|
pombe   132 LILIFAEVLGLYGLIVALLLNT 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 65/106 (61%)
ATP-synt_C 127..187 CDD:278563 43/59 (73%)
vma3NP_594799.1 V_ATP_synt_C 12..117 CDD:130170 65/106 (61%)
PRK09621 13..151 CDD:236595 90/139 (65%)
ATP-synt_C 92..151 CDD:278563 43/58 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53914
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.