DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-5 and atp6v0ca

DIOPT Version :9

Sequence 1:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001098606.2 Gene:atp6v0ca / 192336 ZFINID:ZDB-GENE-020419-23 Length:154 Species:Danio rerio


Alignment Length:149 Identity:100/149 - (67%)
Similarity:119/149 - (79%) Gaps:2/149 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PPYSPFYGVMGVVFSSVLTSAGAAYGTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAIYGLVV 105
            |.||||:.|||...:.|.::.|||||||.|||||||.:||||||:||||||||||||||||||||
Zfish     6 PQYSPFFAVMGASSAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVV 70

  Fly   106 SVLLSGELAPAPKYSLPTGYVHLAAGLSVGFAGLAAGYAVGEVGEVGVRHIALQPRLFIGMILIL 170
            :||::..:  ..|.||...::||.||||||.:|||||:|:|.||:.|||..|.|||||:||||||
Zfish    71 AVLIANNI--GDKISLYKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILIL 133

  Fly   171 IFAEVLGLYGLIIGIYLYT 189
            ||||||||||||:.:.|.|
Zfish   134 IFAEVLGLYGLIVALILST 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 67/106 (63%)
ATP-synt_C 127..187 CDD:278563 44/59 (75%)
atp6v0caNP_001098606.2 V_ATP_synt_C 11..116 CDD:130170 67/106 (63%)
PRK14893 12..154 CDD:184887 95/143 (66%)
ATP-synt_C 90..151 CDD:278563 44/60 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576800
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.