DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-5 and vha-3

DIOPT Version :9

Sequence 1:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001367642.1 Gene:vha-3 / 177018 WormBaseID:WBGene00006912 Length:161 Species:Caenorhabditis elegans


Alignment Length:148 Identity:89/148 - (60%)
Similarity:111/148 - (75%) Gaps:1/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YSPFYGVMGVVFSSVLTSAGAAYGTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAIYGLVVSV 107
            |:||:|.||...:.:.|..|||||||.|..||.:..||||||:|||:|||:|||||.||||||::
 Worm    13 YAPFFGYMGAASAQIFTVLGAAYGTAKSAVGICSMGVMRPELIMKSVIPVIMAGIIGIYGLVVAM 77

  Fly   108 LLSGELAPAPK-YSLPTGYVHLAAGLSVGFAGLAAGYAVGEVGEVGVRHIALQPRLFIGMILILI 171
            :|.|::..|.. |.|..|:.||||||:.|..||.||||:|.||:.|||..|.|||||:|||||||
 Worm    78 VLKGKVTSASAGYDLNKGFAHLAAGLTCGLCGLGAGYAIGIVGDAGVRGTAQQPRLFVGMILILI 142

  Fly   172 FAEVLGLYGLIIGIYLYT 189
            |:|||||||:|:.:.|.|
 Worm   143 FSEVLGLYGMIVALILGT 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 60/107 (56%)
ATP-synt_C 127..187 CDD:278563 41/59 (69%)
vha-3NP_001367642.1 V_ATP_synt_C 16..124 CDD:130170 60/107 (56%)
ATP-synt_Vo_c_ATP6C_rpt2 92..158 CDD:349416 43/65 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.