DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-5 and Atp6v0c

DIOPT Version :9

Sequence 1:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001348460.1 Gene:Atp6v0c / 11984 MGIID:88116 Length:214 Species:Mus musculus


Alignment Length:149 Identity:98/149 - (65%)
Similarity:117/149 - (78%) Gaps:2/149 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PPYSPFYGVMGVVFSSVLTSAGAAYGTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAIYGLVV 105
            |.||.|:||||...:.|.::.|||||||.|||||||.:||||||:||||||||||||||||||||
Mouse    67 PEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVV 131

  Fly   106 SVLLSGELAPAPKYSLPTGYVHLAAGLSVGFAGLAAGYAVGEVGEVGVRHIALQPRLFIGMILIL 170
            :||::..|...  .:|...::.|.||||||.:|||||:|:|.||:.|||..|.|||||:||||||
Mouse   132 AVLIANSLTDG--ITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILIL 194

  Fly   171 IFAEVLGLYGLIIGIYLYT 189
            ||||||||||||:.:.|.|
Mouse   195 IFAEVLGLYGLIVALILST 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 66/106 (62%)
ATP-synt_C 127..187 CDD:278563 43/59 (73%)
Atp6v0cNP_001348460.1 V_ATP_synt_C 72..177 CDD:130170 66/106 (62%)
ATP-synt_C 152..211 CDD:306615 43/58 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834103
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S170
OMA 1 1.010 - - QHG53914
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.760

Return to query results.
Submit another query.