DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpy-30L1 and R05G6.5

DIOPT Version :10

Sequence 1:NP_609445.1 Gene:Dpy-30L1 / 34480 FlyBaseID:FBgn0032293 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_501212.1 Gene:R05G6.5 / 187622 WormBaseID:WBGene00019899 Length:188 Species:Caenorhabditis elegans


Alignment Length:35 Identity:16/35 - (45%)
Similarity:22/35 - (62%) Gaps:0/35 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RQYLDQTVAPVLLHGMQALARERPTDPIQFLASYL 113
            :.||...|.|.|..|:..:|.|||.:||::||.||
 Worm   149 KDYLSVEVWPKLSQGLARVAVERPDNPIKWLADYL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dpy-30L1NP_609445.1 DD_DPY30_SDC1 78..118 CDD:438534 16/35 (46%)
R05G6.5NP_501212.1 Dpy-30 147..188 CDD:428357 16/35 (46%)

Return to query results.
Submit another query.