DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC3 and tmem111

DIOPT Version :9

Sequence 1:NP_609444.1 Gene:EMC3 / 34479 FlyBaseID:FBgn0032292 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_031747352.1 Gene:tmem111 / 779530 XenbaseID:XB-GENE-5777177 Length:252 Species:Xenopus tropicalis


Alignment Length:239 Identity:146/239 - (61%)
Similarity:187/239 - (78%) Gaps:3/239 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELLIDPDIRVWVFLPIVLITFLVGIVRHYVSILISTQKKAEITQIQDSQAMIRARLLRENGKYLS 67
            |||:|..||:||.||||.||||..:.....:...:..::.|:..:.|||.:||:|:|||||||:.
 Frog     5 ELLLDSSIRLWVVLPIVCITFLNRLSSARFTPPAAGGERPELEPLSDSQVLIRSRILRENGKYIP 69

  Fly    68 AQSFSMRKNYFNNEETGYFKTQKRAPVAQN---SSAMLTDMVKGNFINVLPMVVIGGWINWMFSG 129
            .|||.|||.|||::|||:||..||..:.:|   ...|:|||:|||..|||||::|||||||.|||
 Frog    70 RQSFLMRKFYFNDQETGFFKKTKRKVIQRNPMTDPTMMTDMMKGNLTNVLPMILIGGWINWAFSG 134

  Fly   130 FVTTKVPFPLTLRFKPMLQRGVELASLDAAWVSSASWYFLNVFGLRSIYTLVLGENNHADQTQAQ 194
            |:|||||||||||||||||||:||.||||:|||||||||||||||||:|||:||::|.|||::..
 Frog   135 FLTTKVPFPLTLRFKPMLQRGIELESLDASWVSSASWYFLNVFGLRSMYTLLLGQDNAADQSRIM 199

  Fly   195 ADAMTGAAMTMPQDPKAAFKAEWEALEITEYHNALKNIDADMLA 238
            .|.|||||:::|.|...||||||||:||:|:|.||:.|:.|::|
 Frog   200 QDQMTGAALSVPPDTNKAFKAEWEAMEISEHHWALEAIEEDLIA 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC3NP_609444.1 DUF106 3..185 CDD:396507 117/184 (64%)
tmem111XP_031747352.1 DUF106 5..190 CDD:396507 117/184 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 265 1.000 Domainoid score I1859
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 319 1.000 Inparanoid score I2486
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482782at2759
OrthoFinder 1 1.000 - - FOG0003058
OrthoInspector 1 1.000 - - otm48793
Panther 1 1.100 - - LDO PTHR13116
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2419
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.