DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC3 and emc3

DIOPT Version :9

Sequence 1:NP_609444.1 Gene:EMC3 / 34479 FlyBaseID:FBgn0032292 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001016907.1 Gene:emc3 / 549661 XenbaseID:XB-GENE-942865 Length:261 Species:Xenopus tropicalis


Alignment Length:239 Identity:153/239 - (64%)
Similarity:190/239 - (79%) Gaps:3/239 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELLIDPDIRVWVFLPIVLITFLVGIVRHYVSILISTQKKAEITQIQDSQAMIRARLLRENGKYLS 67
            |||:|.:||:||.||||.|||.||::|||||||:.:.||....|:.|||.:||:|:|||||||:|
 Frog     5 ELLLDSNIRLWVVLPIVFITFFVGMIRHYVSILLQSDKKLTQEQVSDSQVLIRSRVLRENGKYIS 69

  Fly    68 AQSFSMRKNYFNNEETGYFKTQKR---APVAQNSSAMLTDMVKGNFINVLPMVVIGGWINWMFSG 129
            .|||.|||.:|||.|.|:||..||   .|.......|||||:|||..|||||::||||||..|||
 Frog    70 KQSFLMRKFFFNNSEDGFFKKTKRKVVPPSPMTDPTMLTDMMKGNVTNVLPMILIGGWINMTFSG 134

  Fly   130 FVTTKVPFPLTLRFKPMLQRGVELASLDAAWVSSASWYFLNVFGLRSIYTLVLGENNHADQTQAQ 194
            |||||||||||||||||||:|:||.||||:|||||||||||||||||||:|:||::|.|||::..
 Frog   135 FVTTKVPFPLTLRFKPMLQQGIELLSLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRVM 199

  Fly   195 ADAMTGAAMTMPQDPKAAFKAEWEALEITEYHNALKNIDADMLA 238
            .:.||||||.||.|...|||.||||||:|::..||::::.|:::
 Frog   200 QEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALEDLEEDLMS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC3NP_609444.1 DUF106 3..185 CDD:396507 127/184 (69%)
emc3NP_001016907.1 DUF106 5..190 CDD:396507 127/184 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 265 1.000 Domainoid score I1859
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 319 1.000 Inparanoid score I2486
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482782at2759
OrthoFinder 1 1.000 - - FOG0003058
OrthoInspector 1 1.000 - - otm48793
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1973
SonicParanoid 1 1.000 - - X2419
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.