DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC3 and zgc:86609

DIOPT Version :9

Sequence 1:NP_609444.1 Gene:EMC3 / 34479 FlyBaseID:FBgn0032292 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001009987.2 Gene:zgc:86609 / 494496 ZFINID:ZDB-GENE-050102-7 Length:253 Species:Danio rerio


Alignment Length:238 Identity:156/238 - (65%)
Similarity:195/238 - (81%) Gaps:3/238 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELLIDPDIRVWVFLPIVLITFLVGIVRHYVSILISTQKKAEITQIQDSQAMIRARLLRENGKYLS 67
            |||:|..||:||.||||.|||.||::|||::.||..:||.::.|:.|||.::|:|:||||||||.
Zfish     5 ELLLDSSIRLWVVLPIVFITFFVGVLRHYITKLIHNEKKVDLQQVSDSQVLLRSRILRENGKYLP 69

  Fly    68 AQSFSMRKNYFNNEETGYFKTQKRAPVAQN---SSAMLTDMVKGNFINVLPMVVIGGWINWMFSG 129
            .|||:|||:||||.|||:||..||....:|   ..:|||||:|||..|||||::|||||||.|||
Zfish    70 KQSFAMRKHYFNNPETGFFKKVKRKVTPKNPMTDPSMLTDMMKGNLTNVLPMILIGGWINWAFSG 134

  Fly   130 FVTTKVPFPLTLRFKPMLQRGVELASLDAAWVSSASWYFLNVFGLRSIYTLVLGENNHADQTQAQ 194
            |:|||||||||||||||||||:||.||||:|||||||||||||||||:|||:||::|.|||::..
Zfish   135 FLTTKVPFPLTLRFKPMLQRGIELVSLDASWVSSASWYFLNVFGLRSMYTLILGQDNAADQSRIM 199

  Fly   195 ADAMTGAAMTMPQDPKAAFKAEWEALEITEYHNALKNIDADML 237
            .|.||||||.||.||..|||:|||||||.|:..||:|::.:::
Zfish   200 QDQMTGAAMAMPPDPNKAFKSEWEALEIVEHKWALENVEEELM 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC3NP_609444.1 DUF106 3..185 CDD:396507 127/184 (69%)
zgc:86609NP_001009987.2 DUF106 5..188 CDD:280185 125/182 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595301
Domainoid 1 1.000 275 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E1_KOG3188
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10201
Inparanoid 1 1.050 334 1.000 Inparanoid score I2396
OMA 1 1.010 - - QHG53712
OrthoDB 1 1.010 - - D1482782at2759
OrthoFinder 1 1.000 - - FOG0003058
OrthoInspector 1 1.000 - - otm25215
orthoMCL 1 0.900 - - OOG6_102473
Panther 1 1.100 - - LDO PTHR13116
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1973
SonicParanoid 1 1.000 - - X2419
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.