DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17118 and BUG22

DIOPT Version :9

Sequence 1:NP_723611.1 Gene:CG17118 / 34478 FlyBaseID:FBgn0032291 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_566418.1 Gene:BUG22 / 820410 AraportID:AT3G12300 Length:190 Species:Arabidopsis thaliana


Alignment Length:183 Identity:104/183 - (56%)
Similarity:142/183 - (77%) Gaps:0/183 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYRAAYQKGFLTVLYSVGSSPLNNWSSYTKNGYIKRIYDEDIKSLVLEIMGSNVSTTFIHCPSEC 65
            |::..:|.|||::|||:||.||..|.....:|::||.:|:||:|.|||::|||:.:|:|.||::.
plant     1 MFKNTFQSGFLSILYSLGSKPLQIWDKEVVDGHVKRCHDDDIQSNVLEVVGSNIQSTYITCPADL 65

  Fly    66 KEQLGIKLPFLVLLIKNMHKYFCFEVKIQDDQRFMRRFRVSNFQSKTSVKPFCTAMPMGMSPGWN 130
            ...||||||||||::|:|.|||.||::|.||:...||||.||||:.|.|||:...||:.|..|||
plant    66 SATLGIKLPFLVLVVKDMKKYFSFEIQILDDKNVRRRFRASNFQAVTRVKPYICTMPLKMDEGWN 130

  Fly   131 QIQFNLADFTRRAYGSNYLETVSLQLHANVRIRRIYFADKLYTEAELPNDYRL 183
            |||.||||.||||||:||.||:.:|:|||.|:|||||||:||:|.|||.:::|
plant   131 QIQLNLADLTRRAYGTNYAETLRVQIHANCRLRRIYFADRLYSEEELPPEFKL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17118NP_723611.1 DUF667 1..184 CDD:398611 104/183 (57%)
PHA03247 <193..279 CDD:223021
BUG22NP_566418.1 DUF667 6..185 CDD:282825 103/178 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3213
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1213295at2759
OrthoFinder 1 1.000 - - FOG0005006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12458
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.