DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17118 and cfap20dc

DIOPT Version :9

Sequence 1:NP_723611.1 Gene:CG17118 / 34478 FlyBaseID:FBgn0032291 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_005168825.1 Gene:cfap20dc / 556322 ZFINID:ZDB-GENE-070410-73 Length:731 Species:Danio rerio


Alignment Length:288 Identity:66/288 - (22%)
Similarity:123/288 - (42%) Gaps:23/288 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYRAAYQKGFLTVLYSV-GSSPLNNWSSYTKNGYIKRIYDEDIKSLVLEIMGSNVSTTFIHCPSE 64
            |:|..||.|....::|. |..|:..|..|.:...|.:::|:::|..|..:.| |..|..:..|.:
Zfish     1 MFRNDYQGGLTVDIFSAQGKDPVAKWKLYGRKPSITKVFDKEVKGFVYSLEG-NSQTHKMQLPKD 64

  Fly    65 CKEQLGIKLPFLVLLIK-NMHKYFCFEVKIQDDQRFMRRFRVSNFQSKTSVKPFCTAMPMGM--S 126
            .|..||:...||:|.:. .:.|.|..|..:.|::...||..:|....:.|..|....:|:..  .
Zfish    65 SKMTLGLIQKFLILQVNIPLGKDFSAEFLVTDEEHLKRRLYLSTVHKELSATPLHARIPLTCHNR 129

  Fly   127 PGWNQIQFNLADFTRRAY-GSNYLETVSLQLHANVRIRRIYFADKLYTEAELPNDY---RLMGKP 187
            ..|..:..:|...|...: |:.:|....:.:.|..::|||      :|....|.|:   .:...|
Zfish   130 DTWCNLCIDLDSLTAVIFRGTRFLSLDGIIISACCKVRRI------FTMKNEPADFTDREIRTGP 188

  Fly   188 KDLKKPEKQF--KVQATARPPSPLNTGRGEPGPSKDTDAEATGPATDPMSEPEPALQKSPSPPVP 250
            |:......||  :||..::..:....|:.: |.|:.::.|     |:..|..:.::.|.|:|...
Zfish   189 KEEIPRSCQFPCEVQHVSQLVNMKTLGQTD-GKSESSNGE-----TEDTSGIKASITKGPTPRDS 247

  Fly   251 QKVPSPAASAPPEPATEEPAPQTEATEE 278
            ..:...:....|.|.|...:..:..|:|
Zfish   248 SHIAFGSKVIGPPPLTARKSSTSANTKE 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17118NP_723611.1 DUF667 1..184 CDD:398611 46/190 (24%)
PHA03247 <193..279 CDD:223021 18/88 (20%)
cfap20dcXP_005168825.1 DUF667 6..194 CDD:282825 46/194 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3213
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.