DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17118 and cfap20

DIOPT Version :9

Sequence 1:NP_723611.1 Gene:CG17118 / 34478 FlyBaseID:FBgn0032291 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001004835.1 Gene:cfap20 / 448101 XenbaseID:XB-GENE-6455885 Length:193 Species:Xenopus tropicalis


Alignment Length:183 Identity:112/183 - (61%)
Similarity:148/183 - (80%) Gaps:0/183 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYRAAYQKGFLTVLYSVGSSPLNNWSSYTKNGYIKRIYDEDIKSLVLEIMGSNVSTTFIHCPSEC 65
            |::..:|.|||::|||:||.||..|....:||:||||.|.||:|||||:.|:|||||:|.||::.
 Frog     1 MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEVEGTNVSTTYITCPADP 65

  Fly    66 KEQLGIKLPFLVLLIKNMHKYFCFEVKIQDDQRFMRRFRVSNFQSKTSVKPFCTAMPMGMSPGWN 130
            |:.|||||||||::|||:.|||.|||::.||:...||||.||:||.|.||||...|||.:..|||
 Frog    66 KKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWN 130

  Fly   131 QIQFNLADFTRRAYGSNYLETVSLQLHANVRIRRIYFADKLYTEAELPNDYRL 183
            ||||||:||||||||:||:||:.:|:|||.||||:||:|:||:|.|||.:::|
 Frog   131 QIQFNLSDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17118NP_723611.1 DUF667 1..184 CDD:398611 112/183 (61%)
PHA03247 <193..279 CDD:223021
cfap20NP_001004835.1 DUF667 1..185 CDD:398611 112/183 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005006
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12458
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.