DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17118 and Cfap20dc

DIOPT Version :9

Sequence 1:NP_723611.1 Gene:CG17118 / 34478 FlyBaseID:FBgn0032291 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_038949382.1 Gene:Cfap20dc / 361016 RGDID:1359720 Length:677 Species:Rattus norvegicus


Alignment Length:343 Identity:79/343 - (23%)
Similarity:127/343 - (37%) Gaps:85/343 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYRAAYQKG-FLTVLYSVGSSPLNNWSSYTKNGYIKRIYDEDIKSLVLEIMGSNVSTTFIHCPSE 64
            |::..||.| |:.:..:.|.:|...|........|.:.:|:::||.|..:.||: .|..|..|.|
  Rat     1 MFKNEYQGGAFVEIFSAQGKNPGAKWKILGSPSVIWKEFDKEVKSFVFVLEGSS-QTNRIQLPKE 64

  Fly    65 CKEQLGIKLPFLVLLI-KNMHKYFCFEVKIQDDQRFMRRFRVSNFQSKTSVKPFCTAMPMGMSPG 128
            .|:.||:...||||.| ..:.:.|..|:.|.|.....||..:|....:.|..|....:|:.|...
  Rat    65 NKQILGLIQRFLVLQIYVPLGQDFSTELLITDLGNIKRRLYLSTVHKEVSSTPLHAKIPLFMIKR 129

  Fly   129 --WNQIQFNLADFTRRAY-GSNYLETVSLQLHANVRIRRIYF---------------ADKLYTEA 175
              |..:..:|..||...: |:.:.....:.:.||.::|:|:.               ||.:....
  Rat   130 KIWCNLCIDLVAFTSEIFKGAVFQSLDGIIVSANCKLRKIFTLKFKPRETADRDDEPADIIPRSC 194

  Fly   176 ELPNDY----RLMGKPKDLKKPEKQF------------------------KVQATAR-------- 204
            :|..|.    :|:...| |::.|.:|                        |.|....        
  Rat   195 QLATDVPHVTQLLNMTK-LRQTEIKFGGHPLRSAESDQFISSRAGSVRSSKSQDVCHIAFGSRVL 258

  Fly   205 -PPSPLNTGR----------------------GEPGPSKDTDAEATGPATDPMSEPEPALQKSPS 246
             ||.|  :||                      .:|...|..::..|.....|:||.:.  :|..|
  Rat   259 GPPPP--SGRRNNLRLSAETVRSIGYKNNQSCQQPAEEKHVNSADTSALLIPLSEQQG--EKGSS 319

  Fly   247 PPVPQKVPSPAASAPPEP 264
            .||.|..|.||:...|.|
  Rat   320 HPVKQTTPLPASLPTPYP 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17118NP_723611.1 DUF667 1..184 CDD:398611 51/206 (25%)
PHA03247 <193..279 CDD:223021 25/127 (20%)
Cfap20dcXP_038949382.1 DUF667 1..188 CDD:398611 47/187 (25%)
MSCRAMM_ClfB <299..613 CDD:411414 14/41 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3213
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.