DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17118 and Bug22

DIOPT Version :10

Sequence 1:NP_723611.1 Gene:CG17118 / 34478 FlyBaseID:FBgn0032291 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_609402.1 Gene:Bug22 / 34429 FlyBaseID:FBgn0032248 Length:199 Species:Drosophila melanogaster


Alignment Length:44 Identity:12/44 - (27%)
Similarity:21/44 - (47%) Gaps:1/44 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   526 LTMYLKLQHKDVFELITTYELYGMVKDCIVQLIELDSERAIAML 569
            |.:|....|....||..|.|.:|...| :.:|.|.|.::.:.::
  Fly    88 LALYRACNHAYANELFKTLEGWGARPD-LQRLFEEDDQQELLLV 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17118NP_723611.1 CFA20_dom 1..184 CDD:461521
PHA03247 <193..279 CDD:223021
Bug22NP_609402.1 CFA20_dom 1..185 CDD:461521 12/44 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.