DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17118 and CFAP20

DIOPT Version :9

Sequence 1:NP_723611.1 Gene:CG17118 / 34478 FlyBaseID:FBgn0032291 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_037374.1 Gene:CFAP20 / 29105 HGNCID:29523 Length:193 Species:Homo sapiens


Alignment Length:183 Identity:113/183 - (61%)
Similarity:147/183 - (80%) Gaps:0/183 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYRAAYQKGFLTVLYSVGSSPLNNWSSYTKNGYIKRIYDEDIKSLVLEIMGSNVSTTFIHCPSEC 65
            |::..:|.|||::|||:||.||..|....:||:||||.|.||:||||||.|:|||||:|.||::.
Human     1 MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADP 65

  Fly    66 KEQLGIKLPFLVLLIKNMHKYFCFEVKIQDDQRFMRRFRVSNFQSKTSVKPFCTAMPMGMSPGWN 130
            |:.|||||||||::|||:.|||.|||::.||:...||||.||:||.|.||||...|||.:..|||
Human    66 KKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWN 130

  Fly   131 QIQFNLADFTRRAYGSNYLETVSLQLHANVRIRRIYFADKLYTEAELPNDYRL 183
            ||||||.||||||||:||:||:.:|:|||.||||:||:|:||:|.|||.:::|
Human   131 QIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17118NP_723611.1 DUF667 1..184 CDD:398611 113/183 (62%)
PHA03247 <193..279 CDD:223021
CFAP20NP_037374.1 DUF667 1..185 CDD:398611 113/183 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156665
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3213
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1213295at2759
OrthoFinder 1 1.000 - - FOG0005006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12458
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.