DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17118 and Cfap20

DIOPT Version :9

Sequence 1:NP_723611.1 Gene:CG17118 / 34478 FlyBaseID:FBgn0032291 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_036009655.1 Gene:Cfap20 / 14894 MGIID:107428 Length:280 Species:Mus musculus


Alignment Length:129 Identity:82/129 - (63%)
Similarity:107/129 - (82%) Gaps:0/129 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 STTFIHCPSECKEQLGIKLPFLVLLIKNMHKYFCFEVKIQDDQRFMRRFRVSNFQSKTSVKPFCT 119
            |||:|.||::.|:.|||||||||::|||:.|||.|||::.||:...||||.||:||.|.||||..
Mouse   142 STTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFIC 206

  Fly   120 AMPMGMSPGWNQIQFNLADFTRRAYGSNYLETVSLQLHANVRIRRIYFADKLYTEAELPNDYRL 183
            .|||.:..|||||||||:||||||||:||:||:.:|:|||.||||:||:|:||:|.|||.:::|
Mouse   207 TMPMRLDDGWNQIQFNLSDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17118NP_723611.1 DUF667 1..184 CDD:398611 82/129 (64%)
PHA03247 <193..279 CDD:223021
Cfap20XP_036009655.1 DUF667 <142..272 CDD:398611 82/129 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847075
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3213
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12458
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.